Dbfetch

ID   AM000052; SV 1; linear; genomic DNA; STD; HUM; 3340 BP.
XX
AC   AM000052;
XX
DT   09-JUL-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*130203, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*130203 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3340
RA   Cox S.T.;
RT   ;
RL   Submitted (09-JUN-2005) to the INSDC.
RL   Cox S.T., HLA Research Group, Anthony Nolan Research, The Royal Free
RL   Hospital, Pond Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Variation of HLA-B*1302 - HLA-B*13XX";
RL   Unpublished.
XX
DR   MD5; 40ecac88e23f30e0ce3d04855c3677ed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3340
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(302..374,504..773,1019..1294,1870..2145,2250..2366,
FT                   2808..2840,2947..2990)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q546P4"
FT                   /db_xref="IMGT/HLA:B*13:02:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q546P4"
FT                   /protein_id="CAJ01188.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            302..374
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=1
FT   intron          375..503
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=2
FT   intron          774..1018
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=2
FT   exon            1019..1294
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=3
FT   intron          1295..1869
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=3
FT   exon            1870..2145
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=4
FT   intron          2146..2249
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=4
FT   exon            2250..2366
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=5
FT   intron          2367..2807
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=5
FT   exon            2808..2840
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=6
FT   intron          2841..2946
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=6
FT   exon            2947..2990
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*130203"
FT                   /number=7
XX
SQ   Sequence 3340 BP; 625 A; 965 C; 1049 G; 701 T; 0 other;
     tggtgtagga gaagagggat caggacgaag tcccaggtcc cggacggggc tctcagggtc        60
     tcaggctccg agagccttgt ctgcattggg gaggcgcagc gttggggatt ccccactccc       120
     acgagtttca cttcttctcc caacctatgt cgggtccttc ttccaggata ctcgtgacgc       180
     gtccccaatt cccactccca ttgggtgtcg ggtgtctaga gaagccaatc agtgtcgccg       240
     gggtcccagt tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga       300
     gatgcgggtc acggcgcccc gaaccctcct cctgctgctc tggggggcag tggccctgac       360
     cgagacctgg gccggtgagt gcgggatcgg gagggaaatg gcctctgtgg ggaggagcga       420
     ggggaccgca ggcgggggcg caggacccgg ggagccgcgc cgggaggagg gtctggcggg       480
     tctcagcccc tcctggcccc caggctccca ctccatgagg tatttctaca ccgccatgtc       540
     ccggcctggc cgcggggagc cccgcttcat caccgtgggc tacgtggacg acacccagtt       600
     cgtgaggttc gacagcgacg ccacgagtcc gaggatggcg ccccgggcgc catggataga       660
     gcaggagggg ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac       720
     ttaccgagag aacctgcgca ccgcgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgactcc ccatccccca cggacggccc gggtcgcccc       840
     gagtctccgg gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc       900
     ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg       960
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcggggcc ggggccaggg      1020
     tctcacactt ggcagacgat gtatggctgc gacctggggc cggacgggcg cctcctccgc      1080
     gggcataacc agttagccta cgacggcaag gattacatcg ccctgaacga ggacctgagc      1140
     tcctggaccg cggcggacac cgcggctcag atcacccagc tcaagtggga ggcggcccgt      1200
     gtggcggagc agctgagagc ctacctggag ggcgagtgcg tggagtggct ccgcagatac      1260
     ctggagaacg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1320
     ccatctccta taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag      1380
     cgctagaatg tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg      1440
     agggccccct cttctctcta ggacaattaa gggatgacgt ctctgaggaa atgtagggga      1500
     agacagtccc tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac      1560
     cgtgactttt cctctcaggc cttgttctct gcctcacact cagtgtgttt ggggctctga      1620
     ttccagcact tctgagtcac tttacctcca ctcagatcag gagcagaagt ccctgttccc      1680
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1740
     tggtgtctgg gttctgtgcc ccttccccac cccaggtgtc ctgtccattc tcaggctggt      1800
     cacatgggtg gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct      1860
     tcccatcaga ccccccaaag acacacgtga cccaccaccc catctctgac catgaggcca      1920
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca ggagatagaa      2040
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      2100
     atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg      2160
     aggggtcata tctcttctca gggaaagcag gagcccttct ggagcccttc agcagggtca      2220
     gggcccctca tcttcccctc ctttcccaga gccatcttcc cagtccaccg tccccatcgt      2280
     gggcattgtt gctggcctgg ctgtcctagc agttgtggtc atcggagctg tggtcgctgc      2340
     tgtgatgtgt aggaggaaga gctcaggtag ggaaggggtg aggggtgggg tctgggtttt      2400
     cttgtcccac tgggggtttc aagccccagg tagaagtgtt ccctgcctca ttactgggaa      2460
     gcagcatgca cacaggggct aacgcagact gggaccctgt gtgccagcac ttactctttt      2520
     gtgcagcaca tgtgacaatg aagcacggat gtatcacctt gatggttgtg gtgttggggt      2580
     cctgattcca gcattcatga gtcaggggaa ggtccctgct aaggacagac cttaggaggg      2640
     cagttggtcc aggacccaca cttgctttcc tcgtgtttcc tgatcctgcc ctgggtctgt      2700
     agtcatactt ctggaaattc cttttgggtc caagactagg aggttcctct aagatctcat      2760
     ggccctgctt cctcccagtc ccctcacagg acattttctt cccacaggtg gaaaaggagg      2820
     gagctactct caggctgcgt gtaagtggtg ggggtgggag tgtggaggag ctcacccacc      2880
     ccataattcc tcctgtccca cgtctcctgc gggctctgac caggtcctgt ttttgttcta      2940
     ctccaggcag cgacagtgcc cagggctctg atgtgtctct cacagcttga aaaggtgaga      3000
     ttcttggggt ctagagtggg cggggggggt ggtggggcag aggggaaagg cctgggtaat      3060
     ggacattctt tgattgggat gtttcgcgtg tgtggtgggc tgtttagagt gtcatcactt      3120
     accatgacta accagaattt gttcatgact gttgttttct gtagcctgag acagctgtct      3180
     tgtgagggac cgagatgcag gatttcttca cgcctcccct ttgtgacttc aagagcctct      3240
     ggcatctctt tctgcaaagg cacctgaatg tgtctgtgtc cctgttagca taatgtgagg      3300
     aggtggagag acagcccaac tgtgtgtcca ctgtgacccc                            3340
//