Dbfetch

ID   AM000036; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM000036;
XX
DT   09-AUG-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC Class II antigen, HLA-DRB1*1104
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1104 allele; major histocompatibility complex;
KW   MHC Class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (09-JUN-2005) to the INSDC.
RL   Poli F., D.T.R.T.O.T., Ospedale Maggiore Policlinico di Milano, Via
RL   Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00484.x.
RX   PUBMED; 16305688.
RA   Longhi E., Frison S., Andreini S., Favoino B., Poli F., Scalamogna M.;
RT   "Description of a new HLA-DRB1*1104, DRB1*110403";
RL   Tissue Antigens 66(6):700-701(2005).
XX
DR   MD5; 7685e0a4895594224ce81836a9551230.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /sex="male"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1104"
FT                   /product="MHC Class II antigen"
FT                   /db_xref="GOA:Q4A1S0"
FT                   /db_xref="IMGT/HLA:DRB1*11:04:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q4A1S0"
FT                   /protein_id="CAJ01187.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1104"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 61 C; 97 G; 54 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//