Dbfetch

ID   AM000026; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM000026;
XX
DT   11-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*11 allele; human leucocyte antigen;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [30-AUG-2005]
RP   1-270
RA   Day S.;
RT   ;
RL   Submitted (09-JUN-2005) to the INSDC.
RL   Day S., H and I, National Blood Service, Southmead RD, BS10 5ND, UNITED
RL   KINGDOM.
XX
RN   [2]
RA   Day S.;
RT   "Identification of a novel HLA-DRB1*11 variant gene";
RL   Unpublished.
XX
DR   MD5; 268de7a5dc52c0f9ccfd8b8998afec10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q3T976"
FT                   /db_xref="IMGT/HLA:DRB1*08:31"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T976"
FT                   /protein_id="CAJ00865.2"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 60 C; 99 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//