Dbfetch

ID   AK313551; SV 1; linear; mRNA; HTC; HUM; 782 BP.
XX
AC   AK313551;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens cDNA, FLJ94111, Homo sapiens major histocompatibility complex,
DE   class II, DO alpha (HLA-DOA), mRNA.
XX
KW   HTC; HTC_FLI; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-782
RA   Isogai T., Yamamoto J.;
RT   ;
RL   Submitted (11-JAN-2008) to the INSDC.
RL   Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11
RL   Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RA   Wakamatsu A., Yamamoto J., Kimura K., Kaida T., Tsuchiya K., Iida Y.,
RA   Takayama Y., Murakawa K., Kanehori K., Andoh T., Kagawa N., Sato R.,
RA   Kawamura Y., Tanaka S., Kisu Y., Sugano S., Goshima N., Nomura N.,
RA   Isogai T.;
RT   "NEDO functional analysis of protein and research application project";
RL   Unpublished.
XX
DR   MD5; 6bbfea151437f2647fc732a9bc1c15b3.
DR   Ensembl-Gn; ENSG00000204252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206292; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230141; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231558; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232957; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232962; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235744; homo_sapiens.
DR   Ensembl-Tr; ENST00000229829; homo_sapiens.
DR   Ensembl-Tr; ENST00000383226; homo_sapiens.
DR   Ensembl-Tr; ENST00000426070; homo_sapiens.
DR   Ensembl-Tr; ENST00000426685; homo_sapiens.
DR   Ensembl-Tr; ENST00000434335; homo_sapiens.
DR   Ensembl-Tr; ENST00000438987; homo_sapiens.
DR   Ensembl-Tr; ENST00000452598; homo_sapiens.
DR   H-InvDB; HIT000432417_04.4.
DR   H-InvDB; HIT000432417_05.4.
XX
CC   Human cDNA sequencing project focused on splicing variants of mRNA
CC   in NEDO functional analysis of protein and research application
CC   project supported by Ministry of Economy, Trade and Industry,
CC   Japan; cDNA selection for complete cds sequencing: Reverse
CC   Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
CC   (Hitachi) and Japan Biological Informatics Consortium, Japan
CC   (JBIC); cDNA complete cds sequencing: JBIC and Biological
CC   Information Research Center (BIRC), AIST; cDNA library
CC   construction: Helix Research Institute supported by Japan Key
CC   Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
CC   Research Association for Biotechnology, Japan, Biotechnology
CC   Center, National Institute of Technology and Evaluation, Japan and
CC   HRI; cDNA mapping to human genome: Central Research Laboratory,
CC   Hitachi; evaluation and annotation: REPRORI.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..782
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="PEBLM2"
FT                   /clone="PEBLM2004856"
FT                   /cell_type="peripheral blood mononuclear cells (HPBMC5939)"
FT                   /note="cloning vector: pME18SFL3"
FT                   /note="primary culture, peripheral blood mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   CDS             30..782
FT                   /note="Homo sapiens major histocompatibility complex, class
FT                   II, DO alpha (HLA-DOA), mRNA"
FT                   /db_xref="GOA:P06340"
FT                   /db_xref="H-InvDB:HIT000432417_03.4"
FT                   /db_xref="HGNC:HGNC:4936"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:4I0P"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06340"
FT                   /protein_id="BAG36327.1"
FT                   /translation="MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGAS
FT                   GQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSN
FT                   RSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSF
FT                   YSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCA
FT                   LGLAIGLVGFLVGTVLIIMGTYVSSVPR"
XX
SQ   Sequence 782 BP; 146 A; 256 C; 219 G; 161 T; 0 other;
     gactgatttg attaaagcac cagagtgtaa tggccctcag agcagggctg gtcctggggt        60
     tccacaccct gatgaccctc ctgagcccgc aggaggcagg ggccaccaag gctgaccaca       120
     tgggctccta cggacccgcc ttctaccagt cttacggcgc ctcgggccag ttcacccatg       180
     aatttgatga ggaacagctg ttctctgtgg acctgaagaa aagcgaggcc gtgtggcgtc       240
     tgcctgagtt tggtgacttt gcccgctttg acccgcaggg cgggctggcc ggcatcgccg       300
     caatcaaagc ccatctggac atcctggtgg agcgctccaa ccgcagcaga gccatcaacg       360
     tgcctccacg ggtgaccgtg ctccccaagt ctcgggtgga gctgggccag cccaacatcc       420
     tcatctgcat cgtggacaac atcttccccc ctgtgatcaa tatcacctgg ctgcgcaacg       480
     gccaaactgt cactgaggga gtggcccaga ccagcttcta ttcccagcct gaccatttgt       540
     tccgcaagtt ccactacctg cccttcgtgc cctcagccga ggacgtctat gactgccagg       600
     tggagcactg gggcctggat gcgccactcc tcaggcattg ggagctccag gtgcctattc       660
     caccaccaga tgccatggag accctggtct gtgccctggg cctggccatc ggcctggtgg       720
     gcttcctcgt gggcaccgtc ctcatcatca tgggcacata tgtgtccagt gtccccaggt       780
     aa                                                                      782
//