Dbfetch

ID   AJ972405; SV 2; linear; genomic DNA; STD; HUM; 3128 BP.
XX
AC   AJ972405;
XX
DT   30-MAY-2005 (Rel. 84, Created)
DT   10-FEB-2016 (Rel. 127, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, HLA-A*02:85 variant
DE   allele,
XX
KW   HLA-A gene; HLA-A*02 variant allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Bengtsson M.;
RT   ;
RL   Submitted (26-MAY-2005) to the INSDC.
RL   Bengtsson M., Oncology, Radiology and Clin Immunology, Section of Clinical
RL   Immunology, Rudbeck Laboratory, University Hospital, S-751 85 Uppsala,,
RL   SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new HLA-A*02 variant";
RL   Unpublished.
XX
DR   MD5; 9eccefc91b7b4341ec1ae0033349bf0f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3128
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(127..199,330..599,841..1116,1717..1992,2092..2208,
FT                   2647..2679,2822..2869,3039..3043)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q4VYE6"
FT                   /db_xref="IMGT/HLA:A*02:85"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VYE6"
FT                   /protein_id="CAI99175.3"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEVAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            127..199
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=1
FT   intron          200..329
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=1
FT   exon            330..599
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=2
FT   intron          600..840
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=2
FT   exon            841..1116
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=3
FT   intron          1117..1716
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=3
FT   exon            1717..1992
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=4
FT   intron          1993..2091
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=4
FT   exon            2092..2208
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=5
FT   intron          2209..2646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=5
FT   exon            2647..2679
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=6
FT   intron          2680..2821
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=6
FT   exon            2822..2869
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=7
FT   intron          2870..3038
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=7
FT   exon            3039..3043
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:85"
FT                   /number=8
XX
SQ   Sequence 3128 BP; 606 A; 892 C; 965 G; 665 T; 0 other;
     acgcggaccc agttctcact cccattgggt gtcgggtttc cagagaagcc aatcagtgtc        60
     gtcgcggtcg cggttctaaa gtccgcacgc acccaccggg actcagattc tccccagacg       120
     ccgaggatgg ccgtcatggc gccccgaacc ctcgtcctgc tactctcggg ggctctggcc       180
     ctgacccaga cctgggcggg tgagtgcggg gtcgggaggg aaacggcctc tgtggggaga       240
     agcaacgggc ccgcctggcg ggggcgcagg acccgggaag ccgcgccggg aggagggtcg       300
     ggcgggtctc agccactcct cgtccccagg ctctcactcc atgaggtatt tcttcacatc       360
     cgtgtcccgg cccggccgcg gggagccccg cttcatcgca gtgggctacg tggacgacac       420
     gcagttcgtg cggttcgaca gcgacgccgc gagccagagg atggagccgc gggcgccgtg       480
     gatagagcag gagggtccgg agtattggga cggggagaca cggaaagtga aggcccactc       540
     acagactcac cgagtggacc tggggaccct gcgcggctac tacaaccaga gcgaggccgg       600
     tgagtgaccc cggcccgggg cgcaggtcac gacctctcat cccccacgga cgggccaggt       660
     cgcccacagt ctccgggtcc gagatccgcc ccgaagccgc gggaccccga gacccttgcc       720
     ccgggagagg cccaggcgcc tttacccggt ttcattttca gtttaggcca aaaatccccc       780
     caggttggtc ggggcggggc ggggctcggg ggaccgggct gaccgcgggg tccgggccag       840
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc       900
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       960
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggtggccc      1020
     atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat      1080
     acctggagaa cgggaaggag acgctgcagc gcacgggtac caggggccac ggggcgcctc      1140
     cctgatcgcc tgtagatctc ccgggctggc ctcccacaag gaggggagac aattgggacc      1200
     aacactagaa tatcgccctc cctctggtcc tgagggagag gaatcctcct gggtttccag      1260
     atcctgtacc agagagtgac tctgaggttc cgccctgctc tctgacacaa ttaagggata      1320
     aaatctctga aggaatgacg ggaagacgat ccctcgaata ctgatgagtg gttccctttg      1380
     acacacacag gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt      1440
     cacactcaat gtgtgtgggg gtctgagtcc agcacttctg agtccttcag cctccactca      1500
     ggtcaggacc agaagtcgct gttccctctt cagggactag aattttccac ggaataggag      1560
     attatcccag gtgcctgtgt ccaggctggt gtctgggttc tgtgctccct tccccatccc      1620
     aggtgtcctg tccattctca agatagccac atgtgtgctg gaggagtgtc ccatgacaga      1680
     tgcaaaatgc ctgaatgatc tgactcttcc tgacagacgc ccccaaaacg catatgactc      1740
     accacgctgt ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg      1800
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg      1860
     tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt      1920
     ctggacagga gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca      1980
     ccctgagatg gggtaaggag ggagacgggg gtgtcatgtc ttttagggaa agcaggagcc      2040
     tctctgacct ttagcagggt cagggcccct caccttcccc tcttttccca gagccgtctt      2100
     cccagcccac catccccatc gtgggcatca ttgctggcct ggttctcttt ggagctgtga      2160
     tcactggagc tgtggtcgct gctgtgatgt ggaggaggaa gagctcaggt ggggaagggg      2220
     tgaagggtgg gtctgagatt tcttgtctca ctgagggttc caagacccag gtagaagtgt      2280
     gccctgcctc gttactggga agcaccaccc acaattatgg gcctacccag cctgggccct      2340
     gtgtgccagc acttactctt ttgtaaagca cctgttaaaa tgaaggacag atttatcacc      2400
     ttgattacag cggtgatggg acctgatccc agcagtcaca agtcacaggg gaaggtccct      2460
     gaggaccttc aggagggcgg ttggtccagg acccacacct gctttcttca tgtttcctga      2520
     tcccgccctg ggtctgcagt cacacatttc tggaaacttc tctgaggtcc aagacttgga      2580
     ggttcctcta ggaccttaag gccctgactc ctttctggta tctcacagga cattttcttc      2640
     ccacagatag aaaaggaggg agctactctc aggctgcaag taagtatgaa ggaggctgat      2700
     gcctgaggtc cttgggatat tgtgtttggg agcccatggg ggagctcacc caccccacaa      2760
     ttcctcctct agccacatct tctgtgggat ctgaccaggt tctgtttttg ttctacccca      2820
     ggcagtgaca gtgcccaggg ctctgatgtg tctctcacag cttgtaaagg tgagagcctg      2880
     gagggcctga tgtgtgttgg gtgttgggcg gaacagtgga cacagctgtg ctatggggtt      2940
     tctttccatt ggatgtattg agcatgcgat gggctgttta aagtgtgacc cctcactgtg      3000
     acagatacga atttgttcat gaatattttt ttctatagtg tgagacagct gccttgtgtg      3060
     ggactgagag gcaagagttg ttcctgccct tccctttgtg acttgaagaa ccctgacttt      3120
     gtttctgc                                                               3128
//