spacer

EBI Dbfetch

ID   AJ969956; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AJ969956;
XX
DT   12-MAY-2005 (Rel. 83, Created)
DT   16-SEP-2010 (Rel. 106, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA*B27var allele,
DE   exon 2 and 3
XX
KW   HLA-B gene; HLA-B*27 allele; human leucocyte antigen B;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Vidan-Jeras B.;
RT   ;
RL   Submitted (11-MAY-2005) to the INSDC.
RL   Vidan-Jeras B., Tissue Typing Center, Blood Transfusion Center of Slovenia,
RL   Slajmerjeva 6, 1000 Ljubljana, SLOVENIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1744-313X.2006.00629.x.
RX   PUBMED; 16984282.
RA   Vidan-Jeras B., Kunilo S., Fae I., Kandus A., Fischer G.F.;
RT   "A novel HLA-B*2730 allele found in a Slovene patient affected with IgA
RT   nephropathy";
RL   Int. J. Immunogenet. 33(5):371-373(2006).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Slovenia"
FT                   /clone="SJ277/40"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27var"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q50HP7"
FT                   /db_xref="IMGT/HLA:B*27:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q50HP7"
FT                   /protein_id="CAI94739.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDRENLRIALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27var"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27var"
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 170 C; 197 G; 70 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer