spacer

EBI Dbfetch

ID   AJ969417; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ969417;
XX
DT   18-MAY-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1450
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1450 allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Joosten I.;
RT   ;
RL   Submitted (09-MAY-2005) to the INSDC.
RL   Joosten I., ABTI 603, University Medical Center St Radboud, P.O. Box 9101,
RL   6500 HB Nijmegen, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00472a.x.
RX   PUBMED; 16185333.
RA   Tijssen H.J., Zeeuw van der S.C., Joosten I.;
RT   "Exon 2 sequence analysis of a novel HLA-DRB1 allele, DRB1*1450";
RL   Tissue Antigens 66(4):332-333(2005).
XX
DR   MD5; 42774ae90ec524038fb67c00b2d8feab.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1450"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:50"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="CAI94542.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPAAEHWNSQKDLLERRRAEVDNYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1450"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 62 C; 102 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgctgc ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaatta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer