spacer

EBI Dbfetch

ID   AJ965497; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AJ965497;
XX
DT   03-MAY-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*02 variant
DE   AHU0105 allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*02 variant AHU0105 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Blasczyk R.;
RT   ;
RL   Submitted (19-APR-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00472d.x.
RX   PUBMED; 16185336.
RA   Horn P.A., Mansmann V., Blasczyk R.;
RT   "Non-expression of HLA-A*0283N";
RL   Tissue Antigens 66(4):335-337(2005).
XX
DR   MD5; 26e02b5c819242785c102f8f50a9c31c.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000413609; homo_sapiens.
DR   Ensembl-Tr; ENST00000438861; homo_sapiens.
DR   Ensembl-Tr; ENST00000453057; homo_sapiens.
DR   Ensembl-Tr; ENST00000453975; homo_sapiens.
DR   Ensembl-Tr; ENST00000455882; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00013003"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..646,747..958)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant AHU0105"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q50I06"
FT                   /db_xref="IMGT/HLA:A*02:83N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q50I06"
FT                   /protein_id="CAI84068.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSG"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant AHU0105"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant AHU0105"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02 variant AHU0105"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 171 A; 243 C; 282 G; 126 T; 200 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg catatgactc accacgctgt       780
     ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggatagga       960
     gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer