spacer

EBI Dbfetch

ID   AJ965439; SV 1; linear; genomic DNA; STD; HUM; 259 BP.
XX
AC   AJ965439;
XX
DT   15-JUN-2005 (Rel. 84, Created)
DT   05-FEB-2010 (Rel. 103, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, exon 2
XX
KW   HLA-DQB1 gene; human leucocyte antigen B; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-259
RA   Brixner V.;
RT   ;
RL   Submitted (18-APR-2005) to the INSDC.
RL   Brixner V., Dept. of Transplantation Immunology, DRK Blutspendedienst Ba
RL   Wue He gGmbH, Sandhofstr. 1, 60528 Frankfurt, GERMANY.
XX
RN   [2]
RA   Brixner V., Seidl C.;
RT   "New DQB1 allele found in a german voluntary blood stem cell donor";
RL   Unpublished.
XX
DR   MD5; d231d8ee1e456a669e5eb93a69b0d10a.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..259
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..259
FT                   /gene="HLA-DQB1"
FT   CDS             <1..>259
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:27:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAI84643.1"
FT                   /translation="YQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAVTPQ
FT                   GRPVAEYWNSQKEVLERTRAXXDXVCRHNYEVAFRGILQR"
FT   exon            1..259
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 259 BP; 56 A; 63 C; 93 G; 42 T; 5 other;
     tgtaccagtt taagggcatg tgctacttca ccaacgggac ggagcgcgtg cgtcttgtaa        60
     ccagacacat ctataaccga gaggagtacg cgcgcttcga cagcgacgtg ggggtgtacc       120
     gggcggtgac gccgcagggg cggcctgttg ccgagtactg gaacagccag aaggaagtcc       180
     tggagaggac ccgggcgkmg ktggacasrg tgtgcagaca caactacgag gtggcgttcc       240
     gcgggatctt gcagaggag                                                    259
//


spacer
spacer