Dbfetch

ID   AJ937958; SV 1; linear; genomic DNA; STD; HUM; 992 BP.
XX
AC   AJ937958;
XX
DT   13-APR-2005 (Rel. 83, Created)
DT   11-AUG-2010 (Rel. 105, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*4405var allele,
DE   exons 1-3 (incomplete sequence coverage)
XX
KW   HLA-B gene; HLA-B*4405var allele; human leucocyte antigen B;
KW   incomplete sequence coverage; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-992
RA   Mrazek F.;
RT   ;
RL   Submitted (07-APR-2005) to the INSDC.
RL   Mrazek F., Dept of Immunology, HLA Laboratory, Palacky University Hospital,
RL   I.P.Pavlova str. 6, CZ-775 20, CZECH REPUBLIC.
XX
RN   [2]
RA   Mrazek F., Fae I., Ambruzova Z., Raida L., Kriegova E., Indrak K.,
RA   Fischer G.F., Petrek M.;
RT   "A single amino acid exchange shifts the serological reactivity of the
RT   novel HLA-B*4442 allele product from HLA-B44 to HLA-B21";
RL   Int. J. Immunogenet. 33(3):197-200(2010).
XX
DR   MD5; 676901d933c8f56b285fe7e958158cf9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..992
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Czech Republic"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,202..471,717..>992)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4405var"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,717..>992)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4405var"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q571Q4"
FT                   /db_xref="IMGT/HLA:B*44:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q571Q4"
FT                   /protein_id="CAI79093.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4405var"
FT                   /number=1
FT   gap             74..201
FT                   /estimated_length=128
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4405var"
FT                   /number=2
FT   gap             472..716
FT                   /estimated_length=245
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4405var"
FT                   /number=3
XX
SQ   Sequence 992 BP; 122 A; 200 C; 214 G; 83 T; 373 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn ngctcccact ccatgaggta tttctacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatca ccgtgggcta cgtggacgac acgctgttcg       300
     tgaggttcga cagcgacgcc acgagtccga ggaaggagcc gcgggcgcca tggatagagc       360
     aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt       420
     accgagagaa cctgcgcacc gcgctccgct actacaacca gagcgaggcc gnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc       720
     tcacatcatc cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gtatgaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc       840
     ctggaccgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt       900
     ggcggagcag gacagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gg                                     992
//