spacer

EBI Dbfetch

ID   AJ890835; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   AJ890835;
XX
DT   11-JUN-2005 (Rel. 84, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*26 new
DE   allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*26 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RA   Poli F.;
RT   ;
RL   Submitted (11-MAR-2005) to the INSDC.
RL   Poli F., D.T.R.T.O.T., Fond. IRCCS Ospedale Maggiore Policlinico, Via
RL   Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00468.x.
RX   PUBMED; 16185330.
RA   Longhi E., Frison S., Colombini I., Malagoli A., Crespiatico L., Poli F.;
RT   "HLA-A*2626, a new allele identified through external proficiency-testing
RT   exercise";
RL   Tissue Antigens 66(4):325-326(2005).
XX
DR   MD5; 8a73fdd77abb9b87e406ede0358148c9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,511..786,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q4QZC0"
FT                   /db_xref="IMGT/HLA:A*26:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q4QZC0"
FT                   /protein_id="CAI68021.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRLAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /number=2
FT   gap             271..510
FT                   /estimated_length=240
FT   intron          271..510
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /number=2
FT   exon            511..786
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /number=3
FT   gap             787..1366
FT                   /estimated_length=580
FT   intron          787..1366
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /number=3
FT   exon            1367..1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /number=4
XX
SQ   Sequence 1642 BP; 167 A; 248 C; 287 G; 120 T; 820 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gttctcacac catccagagg atgtatggct       540
     gcgacgtggg gccggacggg cgcttcctcc gcgggtacca gcaggacgct tacgacggca       600
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       660
     agatcaccca gcgcaagtgg gagacggccc atgaggcgga gcagtggaga gcctacctgg       720
     agggccggtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       780
     gcacggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaagacg      1380
     catatgactc accacgctgt ctctgaccat gaggccaccc tgaggtgctg ggccctgagc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1500
     acggagctcg tggagaccag gcttgcaggg gatgggacct tccagaagtg ggcgtctgtg      1560
     gtggtgcctt ctggacagga gcagagatac acctgccatg tgcagcatga gggtctgccc      1620
     aagcccctca ccctgagatg gg                                               1642
//


spacer
spacer