spacer

EBI Dbfetch

ID   AJ889845; SV 1; linear; genomic DNA; STD; HUM; 1516 BP.
XX
AC   AJ889845;
XX
DT   11-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*31 allele
DE   0102AHU1104, exons 2-3, (incomplete sequence coverage)
XX
KW   HLA-A gene; HLA-A*31 variant allele; human leucocyte antigen A;
KW   incomplete sequence coverage; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1516
RA   Blasczyk R.;
RT   ;
RL   Submitted (08-MAR-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Gervais T., Hundt A., Mueller K., Blasczyk R.;
RT   "A new HLA-A*3101 intron variant.";
RL   Unpublished.
XX
DR   MD5; 9007c978dfed73e23a633f9b3ea6c24b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1516
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00006783"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          1..129
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT                   /number=1
FT   mRNA            join(<130..399,641..>916)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT   CDS             join(<130..399,641..>916)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5CAR1"
FT                   /db_xref="IMGT/HLA:A*31:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CAR1"
FT                   /protein_id="CAI64374.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            130..399
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT                   /number=2
FT   gap             400..640
FT                   /estimated_length=241
FT   exon            641..916
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT                   /number=3
FT   intron          917..1516
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*31 variant 0102AHU1104"
FT                   /number=3
XX
SQ   Sequence 1516 BP; 250 A; 376 C; 409 G; 240 T; 241 other;
     gtgagtgcgg ggtcgtgggg aaaccgcctc tgcggggaga agcaaggggc ccgcccggcg        60
     ggggcgcagg acccgggtag ccgcgccggg aggagggtcg ggcggatctc agccactcct       120
     cgcccccagg ctcccactcc atgaggtatt tcaccacatc cgtgtcccgg cccggccgcg       180
     gggagccccg cttcatcgcc gtgggctacg tggacgacac gcagttcgtg cggttcgaca       240
     gcgacgccgc gagccagagg atggagccgc gggcgccgtg gatagagcag gagaggcctg       300
     agtattggga ccaggagaca cggaatgtga aggcccactc acagattgac cgagtggacc       360
     tggggaccct gcgcggctac tacaaccaga gcgaggccgn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gttctcacac catccagatg       660
     atgtatggct gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc       720
     tacgacggca aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac       780
     atggcggctc agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga       840
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       900
     acgctgcagc gcacgggtac cagggaccac ggggcgcctc cctgatcgcc tgtagatctc       960
     ccgggctggc ctcccacaag gaggggagac aattgggacc aacactagaa tatcaccctc      1020
     cctctggtcc tgagggagag gaatcctcct gggtttccag atcctgtacc agagagtgac      1080
     tctgaggttc cgccctgctc tgtgacacaa ttaagggata aaatctctga aggaatgacg      1140
     ggaagacgat ccctcgaata ctgatgagtg gttccctttg acacacaccg gcagcagcct      1200
     tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat gtgtgtgggg      1260
     gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc agaagtcgct      1320
     gttccctctt cagggactag aattttccac ggaataggag attatcccag gtgcctgtgt      1380
     ccaggctggt gtctgggttc tgtgctccct tccccatccc aggtgtcctg tccattctca      1440
     agatagccac atgtgtgctg gaggagtgtc ccattacaga tgcaaaatgc ctgaatgttc      1500
     tgactcttcc tgacag                                                      1516
//


spacer
spacer