spacer

EBI Dbfetch

ID   AJ878879; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ878879;
XX
DT   02-FEB-2006 (Rel. 86, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, isolate 28004,
DE   exon 4
XX
KW   HLA-A gene; human leucocyte antigen A; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (02-FEB-2005) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., Gervais T., van den Berg-Loonen E.M.;
RT   "New and confirmatory HLA sequences by SBT";
RL   Unpublished.
XX
DR   MD5; 6eab2f4bd3c758c828e827f2ab68c9ae.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229215; homo_sapiens.
DR   Ensembl-Tr; ENST00000376802; homo_sapiens.
DR   Ensembl-Tr; ENST00000376806; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
DR   Ensembl-Tr; ENST00000416096; homo_sapiens.
DR   Ensembl-Tr; ENST00000417978; homo_sapiens.
DR   Ensembl-Tr; ENST00000431930; homo_sapiens.
DR   Ensembl-Tr; ENST00000442939; homo_sapiens.
DR   Ensembl-Tr; ENST00000443552; homo_sapiens.
DR   Ensembl-Tr; ENST00000444289; homo_sapiens.
DR   Ensembl-Tr; ENST00000549869; homo_sapiens.
DR   Ensembl-Tr; ENST00000551120; homo_sapiens.
DR   Ensembl-Tr; ENST00000552193; homo_sapiens.
DR   Ensembl-Tr; ENST00000552498; homo_sapiens.
DR   Ensembl-Tr; ENST00000620168; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="28004"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*24:02:07"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q2L4E7"
FT                   /protein_id="CAI48029.1"
FT                   /translation="PPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /number=4
XX
SQ   Sequence 276 BP; 62 A; 85 C; 85 G; 44 T; 0 other;
     acccccccaa gacacatatg acccaccacc ccatctctga ccatgaggcc actctgagat        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggggagg       120
     accagaccca ggacacggag cttgtggaga ccaggcctgc aggggatgga accttccaga       180
     agtgggcagc tgtggtggta ccttctggag aggagcagag atacacctgc catgtgcagc       240
     atgagggtct gcccaagccc ctcaccctga gatggg                                 276
//


spacer
spacer