spacer

EBI Dbfetch

ID   AJ875234; SV 1; linear; genomic DNA; STD; ROD; 495 BP.
XX
AC   AJ875234;
XX
DT   30-JAN-2005 (Rel. 82, Created)
DT   19-JAN-2006 (Rel. 86, Last updated, Version 3)
XX
DE   Tatera robusta mitochondrial partial cytb gene for cytochrome b, specimen
DE   voucher ET107
XX
KW   cytb gene; cytochrome b.
XX
OS   Gerbilliscus robustus (Fringe-tailed gerbil)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbilliscus.
OG   Mitochondrion
XX
RN   [1]
RP   1-495
RA   Colangelo P.;
RT   ;
RL   Submitted (10-JAN-2005) to the INSDC.
RL   Colangelo P., Biologia Animale e dell'Uomo, Universita di Roma 'La
RL   Sapienza', Via Borelli 50, 00161, ITALY.
XX
RN   [2]
RX   DOI; 10.1016/j.ympev.2005.02.012.
RX   PUBMED; 15878125.
RA   Colangelo P., Corti M., Verheyen E., Annesi F., Oguge N., Makundi R.H.,
RA   Verheyen W.;
RT   "Mitochondrial phylogeny reveals differential modes of chromosomal
RT   evolution in the genus Tatera (Rodentia: Gerbillinae) in Africa";
RL   Mol. Phylogenet. Evol. 35(3):556-568(2005).
XX
DR   MD5; c19066dd865a403967b7042e8b671fa5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..495
FT                   /organism="Gerbilliscus robustus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Ethiopia"
FT                   /specimen_voucher="ET107"
FT                   /db_xref="taxon:410303"
FT   CDS             1..>495
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q5GMY0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5GMY0"
FT                   /protein_id="CAI44750.1"
FT                   /translation="MMNTRKTHPLLKIINNSFIDLPTPSNISSWWNFGSLLGLCLIIQI
FT                   ITGLFLAMHYTADTTTAFSSVSHICRDVNYGWLIRYIHANGASMFFICLFIHIGRGIYY
FT                   GSYLFTETWNIGVILLFFVMATAFLGYVLPWGQMSFWGATVITNLLSAIPYVGTTIVEW
FT                   IW"
XX
SQ   Sequence 495 BP; 149 A; 113 C; 71 G; 162 T; 0 other;
     atgataaata cacgaaaaac ccacccacta ctaaaaatta ttaacaactc attcattgat        60
     ctacctactc cctctaacat ttcatcatga tgaaatttcg gttcactcct aggcctttgc       120
     ctaattatcc aaattattac aggactattt ttagcaatac attacacagc agacacaaca       180
     acagcatttt catccgtatc ccacatttgc cgagacgtca attacggctg attaattcgc       240
     tacattcatg caaacggagc atccatattt ttcatctgct tattcattca cattggacga       300
     ggaatctatt atggatctta tcttttcaca gaaacctgga atattggggt tatccttcta       360
     tttttcgtta tagccactgc atttttaggt tatgttcttc catggggaca gatatctttc       420
     tggggagcga cagtcatcac aaatttgctt tcagccatcc catatgtagg tacaacaatt       480
     gtagaatgaa tctga                                                        495
//


spacer
spacer