Dbfetch

ID   AJ875013; SV 1; linear; genomic DNA; STD; HUM; 272 BP.
XX
AC   AJ875013;
XX
DT   13-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*15
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-272
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (11-JAN-2005) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Huang A., Sibilia P., Yu N.;
RT   "HLA-DRB1 allele with reading frame shift arisen via gene conversion";
RL   Unpublished.
XX
DR   MD5; 144bb2b333598e337a466ba9fa3c2e54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..272
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>272
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting protein"
FT                   /db_xref="GOA:Q5JZX3"
FT                   /db_xref="IMGT/HLA:DRB1*15:17N"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5JZX3"
FT                   /protein_id="CAI44592.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDRRGPRWTPTADTTTGLWRASQCSGE"
FT   exon            1..272
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /number=2
XX
SQ   Sequence 272 BP; 57 A; 66 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgcgggccgc ggtggacacc tactgcagac acaactacgg       240
     ggttgtggag agcttcacag tgcagcggcg ag                                     272
//