spacer

EBI Dbfetch

ID   AJ871635; SV 2; linear; genomic DNA; STD; HUM; 819 BP.
XX
AC   AJ871635;
XX
DT   05-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, exons 1-3,
DE   HLA-Cw*04 variant MVE1204 allele
XX
KW   HLA-C gene; HLA-Cw*04 variant MVE1204 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Blasczyk R.;
RT   ;
RL   Submitted (04-JAN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [3]
RP   1-819
RA   Blasczyk R.;
RT   ;
RL   Submitted (01-JUN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
DR   MD5; 4efa2ddf1b5cd01b756c8f3d1ae4e804.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00013012"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04 variant MVE1204 allele"
FT                   /number=1
FT   CDS             join(1..73,174..443,544..>819)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04 variant MVE1204 allele"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5K018"
FT                   /db_xref="IMGT/HLA:C*04:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K018"
FT                   /protein_id="CAI40345.2"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04 variant MVE1204 allele"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04 variant MVE1204 allele"
FT                   /number=3
XX
SQ   Sequence 819 BP; 118 A; 194 C; 223 G; 84 T; 200 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgctgtgtc ccggcccggc cgcggggagc cccacttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     aagaggggag ccgcgggagc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacaggc tgaccgagtg aacctgcgga aactgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtttg gctgcgacct ggggccggac gggcgcctcc       600
     tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg aacgaggatc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagcgg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcgg                              819
//


spacer
spacer