spacer

EBI Dbfetch

ID   AJ871405; SV 5; linear; genomic DNA; STD; HUM; 2078 BP.
XX
AC   AJ871405;
XX
DT   24-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 13)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*01 variant
DE   ERN0604 allele, exons 1-4
XX
KW   HLA-A gene; HLA-A*01 variant ERN0604 allele; human leukocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Blasczyk R.;
RT   ;
RL   Submitted (21-DEC-2004) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [3]
RC   revised by [4]
RA   Blasczyk R.;
RT   ;
RL   Submitted (06-JUN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [4]
RC   revised by [5]
RA   Blasczyk R.;
RT   ;
RL   Submitted (17-JUN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [5]
RP   1-2078
RA   Blasczyk R.;
RT   ;
RL   Submitted (21-JUN-2005) to the INSDC.
RL   Blasczyk R., Department of Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
DR   MD5; bd8c187ae42d1427275fd1bebbaef489.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2078
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHH0309395"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   5'UTR           212..234
FT                   /gene="HLA-A"
FT   CDS             join(235..307,438..707,949..1224,1803..>2078)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5ND69"
FT                   /db_xref="IMGT/HLA:A*03:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ND69"
FT                   /protein_id="CAI39219.4"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            235..307
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=1
FT   intron          308..437
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=1
FT   exon            438..707
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=2
FT   intron          708..948
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=2
FT   exon            949..1224
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=3
FT   intron          1225..1802
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=3
FT   exon            1803..>2078
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01 variant ERN0604"
FT                   /number=4
XX
SQ   Sequence 2078 BP; 381 A; 651 C; 671 G; 375 T; 0 other;
     aaggcggtgt atggattggg gagtcccagc cttggggatt ccccaactcc gcagtttctt        60
     ttctccctct cccaacctac gtagggtcct tcatcctgga tactcacgac gcggacccag       120
     ttctcactcc cattgggtgt cgggtttcca gagaagccaa tcagtgtcgt cgcggtcgct       180
     gttctaaagc ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc       240
     gtcatggcgc cccgaaccct cctcctgcta ctctcggggg ccctggccct gacccagacc       300
     tgggcgggtg agtgcggggt cgggagggaa accgcctctg cggggagaag caaggggccc       360
     tcctggcggg ggcgcaggac cgggggagcc gcgccgggac gagggtcggg caggtctcag       420
     ccactgctcg cccccaggct cccactccat gaggtatttc ttcacatccg tgtcccggcc       480
     cggccgcggg gagccccgct tcatcgccgt gggctacgtg gacgacacgc agttcgtgcg       540
     gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga       600
     ggggccggag tattgggacc aggagacacg gaatgtgaag gcccagtcac agactgaccg       660
     agtggacctg gggaccctgc gcggctacta caaccagagc gaggccggtg agtgaccccg       720
     gccggtggcg caggtcagga cccctcatcc cccacggacg ggccaggtcg cccacagtct       780
     ccgggtccga gatccacccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc       840
     caggcgcctt tacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg       900
     ggctgggcgg ggctcggggg actgggctga ccgcggggtc ggggccaggt tctcacacca       960
     tccagataat gtatggctgc gacgtggggt cggacgggcg cttcctccgc gggtaccggc      1020
     aggacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcttggaccg      1080
     cggcggacat ggcggctcag atcaccaagc gcaagtggga ggcggtccat gcggcggagc      1140
     agcggagagt ctacctggag ggccggtgcg tggacgggct ccgcagatac ctggagaacg      1200
     ggaaggagac gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg      1260
     tagatctccc gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata      1320
     tcaccctccc tctggtcctg agggagagga atcctcctgg gttccagatc ctgtaccaga      1380
     gagtgactct gaggttccgc cctgctctct gacacaatta agggataaaa tctctgaagg      1440
     agtgacggga agacgatccc tcgaatactg atgagtggtt ccctttgaca ccggcagcag      1500
     ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc aatgtgtgtg      1560
     ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg accagaagtc      1620
     gctgttccct tctcagggaa tagaagatta tcccaggtgc ctgtgtccag gctggtgtct      1680
     gggttctgtg ctctcttccc catcccgggt gtcctgtcca ttctcaagat ggccacatgc      1740
     gtgctggtgg agtgtcccat gacagatgca aaatgcctga attttctgac tcttcccgtc      1800
     agaccccccc aagacacata tgacccacca ccccatctct gaccatgagg ccaccctgag      1860
     gtgctgggcc ctgggcttct accctgcgga gatcacactg acctggcagc gggatgggga      1920
     ggaccagacc caggacacgg agctcgtgga gaccaggcct gcaggggatg gaaccttcca      1980
     gaagtgggcg gctgtggtgg tgccttctgg agaggagcag agatacacct gccatgtgca      2040
     gcatgagggt ctgcccaagc ccctcaccct gagatggg                              2078
//


spacer
spacer