spacer

EBI Dbfetch

ID   AJ871399; SV 1; linear; genomic DNA; STD; HUM; 1919 BP.
XX
AC   AJ871399;
XX
DT   11-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens partial MICA gene for truncated MHC class I
DE   polypeptide-related protein A, MICA-U044 allele
XX
KW   MICA gene; MICA-U044 allele;
KW   truncated MHC class I polypeptide-related protein A.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1919
RA   Quiroga I.;
RT   ;
RL   Submitted (23-DEC-2004) to the INSDC.
RL   Quiroga I., Nuffield Department of Surgery, University of Oxford,
RL   Transplant Immunology Lab, Oxford Transplant Centre, Churchill Hospital,
RL   Oxford, OXON, OX3 7LJ, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00574.x.
RX   PUBMED; 16634869.
RA   Quiroga I., Sweeney D., Sutton M., Ahmad T., Walton R., Barnardo M.,
RA   Fuggle S.V.;
RT   "The identification of three novel MICA alleles by sequence-based typing";
RL   Tissue Antigens 67(4):321-325(2006).
XX
DR   MD5; 8fd0c58fbee6a7ed0925f87abce21360.
DR   IMGT/LIGM; AJ871399.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1919
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..256,531..818,1406..1684,1784..1919)
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT   CDS             join(<1..256,531..818,1406..1684,1784..1890)
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /product="truncated MHC class I polypeptide-related protein
FT                   A"
FT                   /db_xref="IMGT/HLA:MICA*053"
FT                   /protein_id="CAI64221.1"
FT                   /translation="EPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQ
FT                   SHWQTFHVSAVAAGCCYFCYYYFLCPLL"
FT   exon            <1..256
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=2
FT   intron          257..530
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=2
FT   exon            531..818
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=3
FT   intron          819..1405
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=3
FT   exon            1406..1684
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=4
FT   intron          1685..1783
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=4
FT   exon            1784..1919
FT                   /gene="MICA"
FT                   /allele="MICA-U044"
FT                   /number=5
XX
SQ   Sequence 1919 BP; 436 A; 511 C; 581 G; 391 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtccg gggatggatc tgtgcagtca        60
     gggtttctcg ctgaggtaca tctggatggt cagcccttcc tgcgctgtga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaataa gacatgggac       180
     agagagacca gggacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggtga gagtcggcag gggcaagagt gactggagag gccttttcca       300
     gaaaagttag gggcagagag cagggacctg tctcttccca ctggatctgg ctcaggctgg       360
     gggtgaggaa tgggggtcag tggaactcag cagggaggtg agccggcact cagcccacac       420
     agggaggcat ggaggagggc cagggaggca taccccctgg gctgagttcc tcacttgggt       480
     ggaaaggtga tgggttcggg aatggagaag tcactgctgg gtgggggcag gcttgcattc       540
     cctccaggag attagggtct gtgagatcca tgaagacaac agcaccagga gctcccagca       600
     tttctactac gatggggagc tcttcctctc ccaaaacctg gagactgagg aatggacagt       660
     gccccagtcc tccagagctc agaccttggc catgaacgtc aggaatttct tgaaggaaga       720
     tgccatgaag accaagacac actatcacgc tatgcatgca gactgcctgc aggaactacg       780
     gcgatatcta gaatccggcg tagtcctgag gagaacaggt accgacgctg gccaggggct       840
     ctcctctccc tccaattctg ctagagttgc ctcacctccc agatgtgtcc agggaaaccc       900
     tccctgtgct atggatgaag gcatttcctg ttggcacatc gtgtcctgat tttcctctat       960
     tgttagagcc actggataaa gacagagggt cagggactgg accatccagt gttgtaatca      1020
     gggcaagtag aggaccctcc gacagaatcc tgagcctgtg gtgggtgtca ggcaggagag      1080
     gaagccttca gggccagggc tgccccctct gcctcccagc ctgcccatcc tggagagttc      1140
     cctcctggcc ccacaaccca ggagtccacc cctgacatcc ccctcctcag catcaatgtg      1200
     gggatcccag agcctgaggc cacagtccca aggcccatcc tcctgccagc ctggaagaac      1260
     tgggccccag agtgaggaca gacttgcagg tcaggggtcc cggagggctt cagccagagt      1320
     gagaacagtg aagagaaaca gccctgttcc tctcccctcc ttagagggga gcagggcttc      1380
     actggctctg ccctttcttc tccagtgccc cccatggtga atgtcacccg cagcgaggcc      1440
     tcagagggca acatcaccgt gacatgcagg gcttccagct tctatccccg gaatatcata      1500
     ctgacctggc gtcaggatgg ggtatctttg agccacgaca cccagcagtg gggggatgtc      1560
     ctgcctgatg ggaatggaac ctaccagacc tgggtggcca ccaggatttg ccgaggagag      1620
     gagcagaggt tcacctgcta catggaacac agcgggaatc acagcactca ccctgtgccc      1680
     tctggtgagc ctagggtgac cctggagagg gtcaggccag ggtagggaca gcagggatgg      1740
     ctgtggctct ctgcccagtg tataacaagt cccttttttt cagggaaagt gctggtgctt      1800
     cagagtcatt ggcagacatt ccatgtttct gctgttgctg ctggctgctg ctatttttgt      1860
     tattattatt ttctatgtcc gttgttgtaa gaagaaaaca tcagctgcag agggtccag       1919
//


spacer
spacer