Dbfetch

ID   AJ871373; SV 1; linear; genomic DNA; STD; HUM; 895 BP.
XX
AC   AJ871373;
XX
DT   24-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*55 allele
XX
KW   HLA-B gene; HLA-B*55 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-895
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (22-DEC-2004) to the INSDC.
RL   Lebedeva T.V., HLA laboratory, American Red Cross New England Region, 180
RL   Rustcraft Rd, Dedham, MA 02026, USA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00442.x.
RX   PUBMED; 16029440.
RA   Lebedeva T.V., Huang A., Ohashi M., Sibilia P., Alosco S.M., Kempenich J.,
RA   Yu N.;
RT   "The recombinant HLA-B*5518 allele supports the evidence of conserved
RT   haplotype association of rare alleles";
RL   Tissue Antigens 66(2):156-159(2005).
XX
DR   MD5; 4e9b7100429340ce4aa55fff34eb673d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             1..>895
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*55:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ND74"
FT                   /protein_id="CAI39208.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   sig_peptide     1..72
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT   mat_peptide     73..>895
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55"
FT                   /product="MHC class I antigen"
XX
SQ   Sequence 895 BP; 190 A; 282 C; 298 G; 125 T; 0 other;
     atgcgggtca cggcaccccg aaccctcctc ctgctgctct ggggggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc catggataga gcaggagggg       240
     ccggagtatt gggaccggga gacacagatc tccaagacca acacacagac ttaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca cacttggcag       360
     acgatgtatg gctgcgacct ggggccggac gggcgcctcc tccgcgggca taaccagtta       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg            895
//