Dbfetch

ID   AJ867236; SV 1; linear; genomic DNA; STD; HUM; 318 BP.
XX
AC   AJ867236;
XX
DT   03-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*1106
DE   allele, exon 2, isolate 43539
XX
KW   HLA-DRB1 gene; HLA-DRB1*1106 allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-318
RA   Hammond L.;
RT   ;
RL   Submitted (02-DEC-2004) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Blood Service, Ely Valley Road,
RL   Pontyclun, Talbot Green CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Hammond L., Darke C., Rowlands J.;
RT   "Confirmatory sequence, genetics and serology of HLA-DRB1*1106.";
RL   Unpublished.
XX
DR   MD5; 3c3c2ffcf99aa9216e14ba1f4c6a9146.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..318
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="43539"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="buffy coat"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..10
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1106"
FT                   /number=1
FT   CDS             <11..>280
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1106"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5QQ11"
FT                   /db_xref="IMGT/HLA:DRB1*11:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QQ11"
FT                   /protein_id="CAI29455.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            11..280
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1106"
FT                   /number=2
FT   intron          281..>318
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1106"
FT                   /number=2
XX
SQ   Sequence 318 BP; 63 A; 78 C; 119 G; 58 T; 0 other;
     gtccccacag cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg        60
     gagcgggtgc ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac       120
     agcgacgtgg gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg       180
     aacagccaga aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac       240
     aactacgggg ctgtggagag cttcacagtg cagcggcgag gtgagcgcgg cgcggggcgg       300
     ggcctgagtc cctgtgag                                                     318
//