spacer

EBI Dbfetch

ID   AJ867235; SV 1; linear; genomic DNA; STD; HUM; 873 BP.
XX
AC   AJ867235;
XX
DT   03-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24 null
DE   allele, exons 2-3, isolate 43623
XX
KW   HLA-A gene; HLA-A*24 null allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-873
RA   Hammond L.;
RT   ;
RL   Submitted (02-DEC-2004) to the INSDC.
RL   Hammond L., Molecular Genetics, Welsh Blood Service, Ely Valley Road,
RL   Pontyclun, Talbot Green CF72 9WB, UNITED KINGDOM.
XX
RN   [2]
RA   Hammond L., Darke C., Rowlands J.;
RT   "Characterisation of expression variants identified by discrepancies in
RT   serological and molecular typing.";
RL   Unpublished.
XX
DR   MD5; bca23168d0a9c9a88af220ad3f73f0a8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..873
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="43623"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="buffy coat"
FT                   /tissue_type="peripheral Blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..61
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /number=1
FT   CDS             join(<62..331,573..763)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5QQ12"
FT                   /db_xref="IMGT/HLA:A*24:48N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QQ12"
FT                   /protein_id="CAI29454.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVA"
FT   exon            62..331
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /number=2
FT   intron          332..572
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /number=2
FT   exon            573..848
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /number=3
FT   intron          849..>873
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 null"
FT                   /number=3
XX
SQ   Sequence 873 BP; 158 A; 284 C; 314 G; 117 T; 0 other;
     agacccggga agccgcgccg ggaggagggt cgggcgggtc tcagccactc ctcgtcccca        60
     ggctcccact ccatgaggta tttctccaca tccgtgtccc ggcccggccg cggggagccc       120
     cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       180
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       240
     gacgaggaga cagggaaagt gaaggcccac tcacagactg accgagagaa cctgcggatc       300
     gcgctccgct actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc       360
     acgacccctc atcccccacg gacgggccgg gtcgcccaca gtctccgggt ccgagatcca       420
     ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg ccttaacccg       480
     gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggccgg gcggggctcg       540
     ggggactggg ctgaccgcgg ggtcggggcc aggttctcac accctccaga tgatgtttgg       600
     ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac caccagtacg cctacgacgg       660
     caaggattac atcgccctga aagaggacct gcgctcttgg accgcggcgg acatggcggc       720
     tcagatcacc aagcgcaagt gggaggcggc ccatgtggcg tagcagcaga gagcctacct       780
     ggagggcacg tgcgtggacg ggctccgcag atacctggag aacgggaagg agacgctgca       840
     gcgcacgggt accaggggcc acggggcgcc tac                                    873
//


spacer
spacer