spacer

EBI Dbfetch

ID   AJ865388; SV 1; linear; genomic DNA; STD; HUM; 819 BP.
XX
AC   AJ865388;
XX
DT   08-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*16 allele,
DE   exons 1-3
XX
KW   HLA-C gene; HLA-Cw*16 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-819
RA   Nesci S.;
RT   ;
RL   Submitted (23-NOV-2004) to the INSDC.
RL   Nesci S., Tissue Typing Laboratory, A.O.San Salvatore, Via Lombroso,
RL   Pesaro, 61100, ITALY.
XX
RN   [2]
RA   Nesci S., Iliescu A., Buffi O., Lucchetti M.;
RT   "Identification of a new HLA-Cw*16 allele with cloning and sequencing.";
RL   Unpublished.
XX
DR   MD5; 21713c1567db97c0e12e3e4b019ae725.
DR   Ensembl-Gn; ENSG00000237022; homo_sapiens.
DR   Ensembl-Tr; ENST00000414249; homo_sapiens.
DR   Ensembl-Tr; ENST00000419590; homo_sapiens.
DR   Ensembl-Tr; ENST00000438171; homo_sapiens.
DR   Ensembl-Tr; ENST00000453809; homo_sapiens.
DR   Ensembl-Tr; ENST00000552865; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..819
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..>819)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5K095"
FT                   /db_xref="IMGT/HLA:C*16:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K095"
FT                   /protein_id="CAI29271.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRA"
FT   mRNA            join(<1..73,174..443,544..>819)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /product="MHC class I antigen"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16"
FT                   /number=3
XX
SQ   Sequence 819 BP; 113 A; 202 C; 222 G; 82 T; 200 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag tggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgcggc ggagcagcag agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcgg                              819
//


spacer
spacer