Dbfetch

ID   AJ865349; SV 1; linear; genomic DNA; STD; HUM; 781 BP.
XX
AC   AJ865349;
XX
DT   24-NOV-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*74del
DE   allele, exons 2-3
XX
KW   HLA-A gene; HLA-A*74del allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-781
RA   Witter K.;
RT   ;
RL   Submitted (23-NOV-2004) to the INSDC.
RL   Witter K., University of Munich, Labor of Immunogenetics, Paul Heyse
RL   Strasse 33, 80336 Munich, GERMANY.
XX
RN   [2]
RA   Witter K., Mautner J., Volgger A., Albert E.D.;
RT   "A novel HLA-A*74 allele detected in a leukocyte cell line possessed a
RT   deletion of two amino acids in beginning of exon 3";
RL   Unpublished.
XX
DR   MD5; d3e79899661e843a4c3ec3f825aac0e4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..781
FT                   /organism="Homo sapiens"
FT                   /isolate="153152"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leucocyte"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,512..>781)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74del"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*74:12N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5TIL1"
FT                   /protein_id="CAI26292.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAHSQTDRVDLGTLRGYYNQSEAGSHTMMYGCDVGPDG
FT                   RLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTCVE
FT                   WLRRYLENGKETLQRT"
FT   mRNA            join(<1..270,512..>781)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74del"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74del"
FT                   /number=2
FT   intron          271..511
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74del"
FT                   /number=2
FT   exon            512..781
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*74del"
FT                   /number=3
FT   variation       524^525
FT                   /allele="HLA-A*7401"
FT                   /replace="ccagat"
FT                   /compare=U17570.1
XX
SQ   Sequence 781 BP; 139 A; 246 C; 284 G; 112 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggccgggg gcgcaggtca       300
     ggacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccgga cggggctcgg       480
     gggactgggc tgaccgtggg gtcggggcca ggttctcaca ccatgatgta tggctgcgac       540
     gtggggccgg acgggcgcct cctccgcggg taccagcagg acgcctacga cggcaaggat       600
     tacatcgcct tgaacgagga cctgcgctct tggaccgcgg cggacatggc ggctcagatc       660
     acccagcgca agtgggaggc ggcccgtgtg gcggagcagt tgagagccta cctggagggc       720
     acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcacg       780
     g                                                                       781
//