spacer

EBI Dbfetch

ID   AJ864516; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ864516;
XX
DT   20-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*56 allele,
DE   exon 3
XX
KW   antigen presenting molecule; HLA-B gene; HLA-B*56 antigen;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Poli F.;
RT   ;
RL   Submitted (18-NOV-2004) to the INSDC.
RL   Poli F., C.T.I.T, Ospedale Maggiore Policlinico di Milano, Via Francesco
RL   Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00458.x.
RX   PUBMED; 16101835.
RA   Frison S., Longhi E., de Arias A.E., Andreini E., Scalamogna M., Poli F.;
RT   "Identification of a new HLA-B variant, HLA-B*5615";
RL   Tissue Antigens 66(3):238-239(2005).
XX
DR   MD5; 8f8edcf2a7aa68cfb7a2f9caa9ca7f4b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5F312"
FT                   /db_xref="IMGT/HLA:B*56:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F312"
FT                   /protein_id="CAI11376.1"
FT                   /translation="SHTWQTMYGCDLGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*56"
FT                   /number=3
XX
SQ   Sequence 276 BP; 53 A; 84 C; 102 G; 37 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer