Dbfetch

ID   AJ853298; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AJ853298;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*54new allele, exon
DE   2-3
XX
KW   HLA-B gene; HLA-B*54new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Rombout A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   Rombout A., Human Genetics, Innogenetics, Industriepark 7 box 4, 9052
RL   Zwijnaarde, BELGIUM.
XX
RN   [2]
RA   Yuping S., Haibo P., Rombout A., Kyle P., De Canck I.;
RT   "Identification of a novel HLA-B*54 allele in a chinese sample.";
RL   Unpublished.
XX
DR   MD5; 2ff50f3c948daf2558e612636ada4d96.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*54:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5W1J8"
FT                   /protein_id="CAH68435.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /number=3
XX
SQ   Sequence 546 BP; 107 A; 169 C; 198 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacctggg gccggacggg cgcctcctcc gcgggcataa ccagttagcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//