Dbfetch

ID   AJ851865; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ851865;
XX
DT   26-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*15 allele,
DE   exon 4
XX
KW   HLA-C gene; HLA-Cw*15 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (22-OCT-2004) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Leisenbach R.;
RT   "A new Cw*15 allele found in a bone marrow donor : a subsitution at
RT   position 757 of the exon 4 leads to the change of the amino acid 229.";
RL   Unpublished.
XX
DR   MD5; 27d15b3fb050dfd6a94ab898f508aab5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:C*15:13"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5W1M0"
FT                   /protein_id="CAH65478.1"
FT                   /translation="HPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   QLVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15"
FT                   /number=4
FT   variation       138
FT                   /allele="Cw*150201"
FT                   /replace="g"
XX
SQ   Sequence 276 BP; 64 A; 84 C; 87 G; 41 T; 0 other;
     aacacccaaa gacacacgtg acccaccatc ccgtctctga ccatgaggcc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacacccag cttgtggaga ccaggccagc aggagatgga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacgtgc catgtgcagc       240
     acgaggggct gccggagccc ctcaccctga gatggg                                 276
//