spacer

EBI Dbfetch

ID   AJ851864; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ851864;
XX
DT   26-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*15 allele,
DE   exon 3
XX
KW   HLA-C gene; HLA-Cw*15 allele; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Dormoy A.;
RT   ;
RL   Submitted (22-OCT-2004) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N., Leisenbach R.;
RT   "A new Cw*15 allele found in a bone marrow donor : a subsitution at
RT   position 757 of the exon 4 leads to the change of the amino acid 229.";
RL   Unpublished.
XX
DR   MD5; 481c2777ce786970206e87b7d35d8e54.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5W1M1"
FT                   /db_xref="IMGT/HLA:C*15:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5W1M1"
FT                   /protein_id="CAH65479.1"
FT                   /translation="SHIIQRMYGCDLGPDGRLLRGHDQLAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15"
FT                   /number=3
XX
SQ   Sequence 276 BP; 54 A; 85 C; 101 G; 36 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcatga ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer