spacer

EBI Dbfetch

ID   AJ851269; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AJ851269;
XX
DT   06-MAY-2005 (Rel. 83, Created)
DT   06-MAY-2005 (Rel. 83, Last updated, Version 1)
XX
DE   Gerbillus gerbillus mitochondrial partial cytochrome b gene
XX
KW   cytb gene; cytochrome b protein.
XX
OS   Gerbillus gerbillus (lesser Egyptian gerbil)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbillus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.D.;
RT   ;
RL   Submitted (21-OCT-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier, Cedex 5,
RL   FRANCE.
XX
RN   [2]
RX   DOI; 10.1016/j.ympev.2005.01.001.
RX   PUBMED; 15878135.
RA   Chevret P.D., Dobigny G.;
RT   "Systematics and evolution of the subfamily Gerbillinae (Mammalia,
RT   Rodentia, Muridae)";
RL   Mol. Phylogenet. Evol. 35(3):674-688(2005).
XX
DR   MD5; 718f3b9ead204ce802f53f4d2f6f0a66.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Gerbillus gerbillus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Mauritania:Nouakchott area"
FT                   /db_xref="taxon:298880"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q50II4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q50II4"
FT                   /protein_id="CAH64874.1"
FT                   /translation="MTNIRKIHPLLKMVNHSFIDLPTPPNISSWWNFGSLLGICLIIQI
FT                   ATGLFLAMHYTADTTTAFSSVSHICRDVNYGWLIRYMHANGASMFFICLFIHIGRGIYY
FT                   GSYIFQETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGPTIVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVLVHLLFLHETGSNNPLGLNSNSDKIPFHP
FT                   YYTVKDFLGVILLLLFFTILVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALVLSILILIFLPLIHTSKQRSLMFRPISQMLYWILIANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILLPXAGIIEDNMLKWY"
XX
SQ   Sequence 1140 BP; 347 A; 303 C; 132 G; 357 T; 1 other;
     atgacaaaca ttcgaaaaat tcacccacta ctaaaaatag tcaaccactc attcattgat        60
     cttcccactc cccctaatat ctcatcttga tgaaactttg gctcacttct aggaatttgc       120
     ttaattattc aaatcgctac aggacttttc ctagccatac attatacagc agacacaaca       180
     acagcattct catcagtatc ccatatctgc cgagacgtca attatggatg actaatccgc       240
     tatatacatg caaacggagc ttcaatattc tttatttgcc tattcattca cattggacga       300
     ggaatttact acggatctta catctttcaa gaaacatgaa acattggagt aattctccta       360
     tttgccgtaa tagccaccgc attcatagga tatgtacttc catgaggaca aatatccttc       420
     tgaggggcca cagtcattac aaatcttctt tcagctattc catatattgg cccaacaatc       480
     gtagaatgaa tttgaggagg attttcagtg gacaaagcca ctttaacacg atttttcgca       540
     tttcacttca ttctcccctt tattatcaca gccttagtcc tagtccatct tctattcctt       600
     cacgaaaccg gatctaataa tcccctaggc cttaactcca actcagacaa aatccctttt       660
     cacccatact acacagtaaa agattttctc ggagtaattc tactacttct atttttcaca       720
     attttagtcc tcttcttccc tgacttactt ggagatccag acaactacac acccgctaac       780
     ccccttaaca ctccccctca cattaaacct gaatgatatt tcttatttgc ctatgctatc       840
     ctacgttcaa ttcctaacaa actaggagga gtcctagccc tagtactttc aatccttatc       900
     ctaattttct taccactcat tcacacatca aaacaacgaa gcctaatatt ccgacctatt       960
     tcccaaatac tttactgaat cttaattgcc aacctactta tcctcacatg aatcggaggc      1020
     caaccagtag aacacccatt tattatcatc ggccaactag cctcaatcag ttacttttcc      1080
     attatcctaa ttcttttacc aakcgcagga atcattgaag ataatatatt aaaatgatat      1140
//


spacer
spacer