Dbfetch

ID   AJ850053; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AJ850053;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*08XX
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*08XX allele; human leucocyte antigen D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hoppe B.;
RT   ;
RL   Submitted (15-OCT-2004) to the INSDC.
RL   Hoppe B., Institute of Transfusion Medicine, Charite Campus
RL   Virchow-Klinikum, Augustenburger Platz 1, Berlin, 13353, GERMANY.
XX
RN   [2]
RA   Hoppe B., Heymann G., Kiesewetter H., Salama A.;
RT   "Identification and characterization of a novel HLA-DRB1 allele,
RT   DRB1*0830";
RL   Tissue Antigens 62(2):160-162(2005).
XX
DR   MD5; 2502b8ef4f57130d7fe8674b127b11a5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5CC31"
FT                   /db_xref="IMGT/HLA:DRB1*08:30:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CC31"
FT                   /protein_id="CAH61416.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08XX"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//