Dbfetch

ID   AJ844895; SV 1; linear; genomic DNA; STD; HUM; 1290 BP.
XX
AC   AJ844895;
XX
DT   08-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*6802 allele,
DE   exons 1-3
XX
KW   HLA-A gene; HLA-A*6802 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1290
RA   Poli F.;
RT   ;
RL   Submitted (06-OCT-2004) to the INSDC.
RL   Poli F., D.T.R.T.O.T., Ospedale Maggiore Policlinico di Milano, Via
RL   Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Sequencing of HLA-A*6802 and of the new HLA-A*68 variant";
RL   Unpublished.
XX
DR   MD5; 0e0373c1ac66f09295438faa17051f25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1290
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(301..373,504..773,1015..>1290)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*68:02:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K146"
FT                   /protein_id="CAH59953.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            301..373
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /number=1
FT   intron          374..503
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /number=1
FT   exon            504..773
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /number=2
FT   intron          774..1014
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /number=2
FT   exon            1015..>1290
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*6802"
FT                   /number=3
XX
SQ   Sequence 1290 BP; 224 A; 420 C; 451 G; 195 T; 0 other;
     caggagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc       360
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       420
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       480
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccatgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccggaa cacacggaat gtgaaggccc agtcacagac       720
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       840
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       900
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       960
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc      1020
     acaccatcca gaggatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt      1080
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt      1140
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg      1200
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgcacgg                                       1290
//