Dbfetch

ID   AJ831405; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AJ831405;
XX
DT   13-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC Class I antigen, exons 2 & 3,
DE   HLA-C*0702-like allele
XX
KW   HLA-Cw gene; human leucocyte antigen C; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Sutton M.;
RT   ;
RL   Submitted (13-SEP-2004) to the INSDC.
RL   Sutton M., Transplant Centre, Transplantation Immunology, Churchill
RL   Hospital, Headington, Oxford, OX3 7LJ, UNITED KINGDOM.
XX
RN   [2]
RA   Sutton M., Sweeney D., Agudelo J.D., Procter J., Barnardo M., Fuggle S.;
RT   "Identification of a novel HLA-C*0702-like allele";
RL   Unpublished.
XX
DR   MD5; eb0c8d8b97a799884e1c0a6524828ada.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            <1..271
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-C*0702-like"
FT                   /number=2
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-C*0702-like"
FT                   /product="MHC class I antigen"
FT                   /function="antigen-presenting molecule"
FT                   /db_xref="IMGT/HLA:C*07:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZGL9"
FT                   /protein_id="CAH40829.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-C*0702-like"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-C*0702-like"
FT                   /number=3
XX
SQ   Sequence 646 BP; 105 A; 173 C; 198 G; 70 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtctggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcag                      646
//