spacer

EBI Dbfetch

ID   AJ812565; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ812565;
XX
DT   02-SEP-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, exons 2-3,
DE   HLA-B*15 allele
XX
KW   HLA-B gene; HLA-B*15 allele; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Velickovic Z.;
RT   ;
RL   Submitted (31-AUG-2004) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.M.;
RT   "Novel HLA-B*15 allele";
RL   Unpublished.
XX
DR   MD5; 601dc663c02f8a99e12ece7b06994570.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q683P8"
FT                   /db_xref="IMGT/HLA:B*15:96"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q683P8"
FT                   /protein_id="CAH23707.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15"
FT                   /number=3
XX
SQ   Sequence 791 BP; 142 A; 263 C; 282 G; 104 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt ggagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg aagaatggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer