spacer

EBI Dbfetch

ID   AJ810847; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AJ810847;
XX
DT   20-AUG-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*01var
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; HLA-DPB1*01var allele; human leucocyte antigen DP;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Fischer G.F.;
RT   ;
RL   Submitted (17-AUG-2004) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20, A-1090 Vienna, AUSTRIA.
XX
RN   [2]
RA   Fae I., Fischer G.F.;
RT   "A novel HLA-DPB1 allele";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Austria"
FT                   /tissue_type="blood"
FT                   /note="laboratory code SJ215/04"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>263
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01var"
FT   CDS             <1..>263
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01var"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q68V11"
FT                   /db_xref="IMGT/HLA:DPB1*01:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q68V11"
FT                   /protein_id="CAH18733.1"
FT                   /translation="NYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRR"
FT   exon            1..263
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01var"
FT                   /number=2
XX
SQ   Sequence 264 BP; 63 A; 64 C; 99 G; 38 T; 0 other;
     agaattacgt gtaccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt acgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcttggagga gaagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//


spacer
spacer