Dbfetch

ID   AJ784258; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AJ784258;
XX
DT   19-JAN-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA B*1527 allele
DE   exon 3
XX
KW   HLA B*1527 allele; HLA-B gene; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Gervais T.G.;
RT   ;
RL   Submitted (19-JUL-2004) to the INSDC.
RL   Gervais T.G., Immunohaematology, UCL Cliniques St Luc, Clos
RL   Chapelle-aux-Champs, 30 POBox 3052, Brussels, 1200, BELGIUM.
XX
RN   [2]
RA   Gervais T.G., Latinne D.;
RT   "Confirmatory sequence for the HLA B*1527 gene obtained by sequence based
RT   typing";
RL   Unpublished.
XX
DR   MD5; 3fdeb331e42b67bd312d4c6267a75664.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="HA048"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1527"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*15:27:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K2Q5"
FT                   /protein_id="CAH04644.1"
FT                   /translation="SHTLQRMFGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 51 A; 84 C; 105 G; 36 T; 0 other;
     ggtctcacac cctccagagg atgtttggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//