spacer

EBI Dbfetch

ID   AJ783756; SV 2; linear; genomic DNA; STD; HUM; 1412 BP.
XX
AC   AJ783756;
XX
DT   30-SEP-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*4427 allele,
DE   exons 1-5,
XX
KW   HLA-B gene; HLA-B*4427 allele; human leukocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (12-JUL-2004) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00654.x.
RX   PUBMED; 16948648.
RA   Voorter C.E.M., Gervais T., Mulkers E.M.T., Latinne D.,
RA   van den Berg-Loonen E.M.;
RT   "Identification of the new allele B*3556 and extension of the sequences of
RT   B*4420 and B*4427";
RL   Tissue Antigens 68(3):253-256(2006).
XX
RN   [3]
RP   1-1412
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (15-AUG-2005) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
DR   MD5; 271e6efb4b8962d4433945326be9c34c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1412
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..>1412)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5ZGX0"
FT                   /db_xref="IMGT/HLA:B*44:27:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZGX0"
FT                   /protein_id="CAH04149.2"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSS"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4427"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1412
FT                   /gene="HLA-B"
FT                   /allele="HLA-xB*4427"
FT                   /number=5
XX
SQ   Sequence 1412 BP; 209 A; 316 C; 332 G; 155 T; 400 other;
     atgcgggtca cggcgccccg aaccctcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       240
     caccgtgggc tacgtggacg acacgctgtt cgtgaggttc gacagcgacg ccacgagtcc       300
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       360
     gacacagatc tccaagacca acacacagac ttaccgagag aacctgcgca ccgcgctccg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca catcatccag aggatgtacg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggta tgaccaggac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcaggac agagcctacc tggagggcct gtgcgtggag tcgctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna ccccccaaag acacatgtga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac cagaccagca      1080
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagt ccaccatccc      1320
     catcgtgggc attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt      1380
     cgctactgtg atgtgtagga ggaagagctc ag                                    1412
//


spacer
spacer