spacer

EBI Dbfetch

ID   AJ749950; SV 1; linear; genomic DNA; STD; HUM; 3351 BP.
XX
AC   AJ749950;
XX
DT   28-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*1542 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*1542 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3351
RA   Dunn P.;
RT   ;
RL   Submitted (25-JUN-2004) to the INSDC.
RL   Dunn P., DNA Reference Laboratory, National Blood Service, Southmead Road,
RL   Bristol BS10 5ND, UNITED KINGDOM.
XX
RN   [2]
RA   Dunn P.;
RT   "Complete nucleotide sequence of a recombinant HLA allele, B*1542";
RL   Unpublished.
XX
DR   MD5; 0f3580bf692bf3c725d800c04ae4d074.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3351
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..375,505..774,1020..1295,1871..2146,2251..2367,
FT                   2809..2841,2948..>3351)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT   exon            <1..375
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=1
FT   CDS             join(303..375,505..774,1020..1295,1871..2146,2251..2367,
FT                   2809..2841,2948..2991)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-B15/B55 recombinant"
FT                   /db_xref="GOA:Q6H8L0"
FT                   /db_xref="IMGT/HLA:B*15:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6H8L0"
FT                   /protein_id="CAG44552.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   intron          376..504
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=1
FT   exon            505..774
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=2
FT   intron          775..1019
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=2
FT   exon            1020..1295
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=3
FT   intron          1296..1870
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=3
FT   exon            1871..2146
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=4
FT   intron          2147..2250
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=4
FT   exon            2251..2367
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=5
FT   intron          2368..2808
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=5
FT   exon            2809..2841
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=6
FT   intron          2842..2947
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=6
FT   exon            2948..3351
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1542"
FT                   /number=7
XX
SQ   Sequence 3351 BP; 625 A; 967 C; 1056 G; 703 T; 0 other;
     ttggtgtagg agaagaggga tcaggacgaa gtcccaggtc ccggacgggg ctctcagggt        60
     ctcaggctcc gagagccttg tctgcattgg ggaggcgcag cgttggggat tccccactcc       120
     cacgagtttc acttcttctc ccaacctatg tcgggtcctt cttccaggat actcgtgacg       180
     cgtccccatt tcccactccc attgggtgtc gggtgtctag agaagccaat cagtgtcgcc       240
     ggggtcccag ttctaaagtc cccacgcacc cacccggact caaaatctcc tcagacgccg       300
     agatgcgggt cacggcgccc cgaaccgtcc tcctgctgct ctcgggagcc ctggccctga       360
     ccgagacctg ggccggtgag tgcggggtcg gcagggaaat ggcctctgtg gggaggagcg       420
     aggggaccgc aggcgggggc gcaggacccg gggagccgcg ccgggaggag ggtcgggcgg       480
     gtctcagccc ctcctcgccc ccaggctccc actccatgag gtatttctac accgccatgt       540
     cccggcccgg ccgcggggag ccccgcttca tcgcagtggg ctacgtggac gacacccagt       600
     tcgtgaggtt cgacagcgac gccgcgagtc cgaggatggc gccccgggcg ccatggatag       660
     agcaggaggg gccggagtat tgggaccggg agacacagat ctccaagacc aacacacaga       720
     cttaccgaga gagcctgcgg aacctgcgcg gctactacaa ccagagcgag gccggtgagt       780
     gaccccggcc tggggcgcag gtcacgactc cccatccccc acgtacggcc cgggtcgccc       840
     cgagtctccg ggtccgagat ccgcccccct gaggccgcgg gacccgccca aaccctcgac       900
     cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc       960
     gggttggtcg gggcggggcg gggctcgggg gacggggctg accgcggggc cggggccagg      1020
     gtctcacact tggcagacga tgtatggctg cgacctgggg ccggacgggc gcctcctccg      1080
     cgggcataac cagttagcct acgacggcaa ggattacatc gccctgaacg aggacctgag      1140
     ctcctggacc gcggcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg      1200
     tgaggcggag cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata      1260
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1320
     cccatctcct ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca      1380
     gcgctagaat gtcgccctcc cttgaatgga gaatggcatg agttttcctg agtttcctct      1440
     gagggccccc tcttctctct aggacaatta agggatgacg tctctgagga aatggagggg      1500
     aagacagtcc ctagaatact gatcaggggt cctctttgac ccctgcagca gccttgggaa      1560
     ccgtgacttt tcctctcagg ccttgttctc tgcctcacac tcagtgtgtt tggggctctg      1620
     attccagcac ttctgagtca ctttacctcc actcagatca ggagcagaag tccctgttcc      1680
     ccgctcagag actcgaactt tccaatgaat aggagattat cccaggtgcc tgcgtccagg      1740
     ctggtgtctg ggttctgtgc cccttcccca ccccaggtgt cctgtccatt ctcaggctgg      1800
     tcacatgggt ggtcctaggg tgtcctatga gagatgcaaa gcgcctgaat tttctgactc      1860
     ttcccatcag accccccaaa gacacacgtg acccaccacc ccatctctga ccatgaggcc      1920
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg      1980
     gatggcgagg accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga      2040
     accttccaga agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc      2100
     catgtacagc atgaggggct gccgaagccc ctcaccctga gatggggtaa ggagggggat      2160
     gaggggtcat atctcttctc agggaaagca ggagcccttc tggagccctt cagcagggtc      2220
     agggcccctc gtcttcccct cctttcccag agccatcttc ccagtccacc atccccatcg      2280
     tgggcattgt tgctggcctg gctgtcctag cagttgtggt catcggagct gtggtcgcta      2340
     ctgtgatgtg taggaggaag agctcaggta gggaaggggt gaggggtggg gtctgggttt      2400
     tcttgtccca ctgggggttt caagccccag gtagaagtgt tccctgcctc attactggga      2460
     agcagcatcc acacaggggc taatgcagcc tgggaccctg tgtgccagca cttactcttt      2520
     tgtgcagcac atgtgacaat gaaggacgga tgtatcacct tgatggttgt ggtgttgggg      2580
     tcctgatttc agcattcatg agtcagggga aggtccctgc taaggacaga ccttaggagg      2640
     gcagttggtc caggacccac acttgctttc ctcgtgtttc ctgatcctgc cttgggtctg      2700
     tagtcatact tctggaaatt ccttttgggt ccaagacgag gaggttcctc taagatctca      2760
     tggccctgct tcctcccagt cccctcacag gacattttct tcccacaggt ggaaaaggag      2820
     ggagctactc tcaggctgcg tgtaagtggt gggggtggga gtgtggagga gctcacccac      2880
     cccataattc ctcctgtccc acgtctcctg cgggctctga ccaggtcctg tttttgttct      2940
     actccagcca gcgacagtgc ccagggctct gatgtgtctc tcacagcttg aaaaggtgag      3000
     attcttgggg tctagagtgg gcgggggggg gtggggtggg gagggggcag aggggaaagg      3060
     cctgggtaat ggagattctt tgattgggat gtttcgcgtg tgtggtgggc tgtttagagt      3120
     gtcatcactt accatgacta accagaattt gttcatgact gttgttttct gtagcctgag      3180
     acagctgtct tgtgagggac tgagatgcag gatttcttca ctcctcccct ttgtgacttc      3240
     aagagcctct ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc cctgttagca      3300
     taatgtgagg aggtggagag acagcccacc cccgtgtcca ctgtgacccc t               3351
//


spacer
spacer