spacer

EBI Dbfetch

ID   AJ749610; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AJ749610;
XX
DT   24-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B*5206 gene for MHC class I antigen, HLA-B*5206
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*5206 allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Woelpl A.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   Woelpl A., Immunogenetics, Laboratory for Medical Genetics, Lochhamer Str.
RL   29, 82152 Martinsried, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00400.x.
RX   PUBMED; 15853905.
RA   Hoelsch K., Lenggeler I., Pfannes W., Knabe H., Klein H.G., Woelpl A.;
RT   "Routine HLA-B genotyping with PCR-sequence-specific oligonucleotides
RT   detects a B*52 variant (B*5206)";
RL   Tissue Antigens 65(5):488-492(2005).
XX
DR   MD5; 3ba46d77aba756f4878e4d1038a09cc3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5206"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B*"
FT                   /allele="HLA-B*5206"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6H8L9"
FT                   /db_xref="IMGT/HLA:B*52:06:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6H8L9"
FT                   /protein_id="CAG44445.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5206"
FT                   /number=2
FT   intron          271..515
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5206"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5206"
FT                   /number=3
XX
SQ   Sequence 791 BP; 144 A; 261 C; 280 G; 106 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gtgctgaccg cggggccggg gccagggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaagat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg g                                                            791
//


spacer
spacer