Dbfetch

ID   AJ748743; SV 1; linear; genomic DNA; STD; HUM; 3094 BP.
XX
AC   AJ748743;
XX
DT   21-SEP-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo Sapiens HLA-A gene for MHC class I antigen, HLA-A*0301 allele, exons
DE   1-8
XX
KW   HLA-A gene; HLA-A*0301 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3094
RA   Marsh S.G.;
RT   ;
RL   Submitted (21-JUN-2004) to the INSDC.
RL   Marsh S.G., Research Institute, Anthony Nolan Trust, The Royal Free
RL   Hospital, Pond Street, London NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Mayor N.P.;
RT   "Full Length Sequence of an HLA-A*0301 Intron 2 variant";
RL   Unpublished.
XX
DR   MD5; 4744e9f0617b3715ed23779866c2e1ba.
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3094
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="variant of HLA-A*0301 with a substitution of G to T
FT                   at nucleotide position 492 in intron 2"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(1..73,204..473,715..990,1569..1844,1947..2063,
FT                   2506..2538,2681..2728,2843..2847)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT   CDS             join(1..73,204..473,715..990,1569..1844,1947..2063,
FT                   2506..2538,2681..2728,2843..2847)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04439"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*03:01:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:2XPG"
FT                   /db_xref="PDB:3RL1"
FT                   /db_xref="PDB:3RL2"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04439"
FT                   /protein_id="CAG38621.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=1
FT   intron          74..203
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=2
FT   intron          474..714
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=3
FT   intron          991..1568
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=3
FT   exon            1569..1844
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=4
FT   intron          1845..1946
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=4
FT   exon            1947..2063
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=5
FT   intron          2064..2505
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=5
FT   exon            2506..2538
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=6
FT   intron          2539..2680
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=6
FT   exon            2681..2728
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=7
FT   intron          2729..2842
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=7
FT   exon            2843..2847
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0301"
FT                   /number=8
XX
SQ   Sequence 3094 BP; 592 A; 882 C; 961 G; 659 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggacgagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccg gtggcgcagg tcaggacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggct gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgagg       900
     cggagcagtt gagagcctac ctggatggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggagtg acgggaagac gatccctcga atactgatga gtggttccct ttgacaccgg      1260
     cagcagcctt gggcccgtga cttttcctct caggccttgt tctctgcttc acactcaatg      1320
     tgtgtggggg tctgagtcca gcacttctga gtccctcagc ctccactcag gtcaggacca      1380
     gaagtcgctg ttcccttctc agggaataga agattatccc aggtgcctgt gtccaggctg      1440
     gtgtctgggt tctgtgctct cttccccatc ccgggtgtcc tgtccattct caagatggcc      1500
     acatgcgtgc tggtggagtg tcccatgaca gatgcaaaat gcctgaattt tctgactctt      1560
     cccgtcagac ccccccaaga cacatatgac ccaccacccc atctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggggaggac cagacccagg acacggagct cgtggagacc aggcctgcag gggatggaac      1740
     cttccagaag tgggcggctg tggtggtgcc ttctggagag gagcagagat acacctgcca      1800
     tgtgcagcat gagggtctgc ccaagcccct caccctgaga tggggtaagg agggagatgg      1860
     gggtgtcatg tctcttaggg aaagcaggag cctctctgga gacctttagc agggtcaggg      1920
     cccctcacct tcccctcttt tcccagagct gtcttcccag cccaccatcc ccatcgtggg      1980
     catcattgct ggcctggttc tccttggagc tgtgatcact ggagctgtgg tcgctgccgt      2040
     gatgtggagg aggaagagct caggtggaga aggggtgaag ggtggggtct gagatttctt      2100
     gtctcactga gggttccaag ccccagctag aaatgtgccc tgtctcatta ctgggaagca      2160
     ccgtccacaa tcatgggcct acccagtctg ggccctgtgt gccagcactt actcttttgt      2220
     aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacggcggt gatgggacct      2280
     gatcccagca gtcacaagtc acaggggaag gtccctgagg acagacctca ggagggctat      2340
     tggtccagga cccacacctg ctttcttcat gtttcctgat cccgccctgg gtctgcagtc      2400
     acacatttct ggaaacttct ctggggtcca agactaggag gttcctctag gaccttaagg      2460
     ccctggctcc tttctggtat ctcacaggac attttcttct cacagataga aaaggaggga      2520
     gttacactca ggctgcaagt aagtatgaag gaggctgatg cctgaggtcc ttgggatatt      2580
     gtgtttggga gcccatgggg gagcccaccc acctcacaat tcctcctcta gccacatctt      2640
     ctgtgggatc tgaccaggtt ctgtttttgt tctaccccag gcagtgacag tgcccagggc      2700
     tctgatgtgt ccctcacagc ttgtaaaggt gagagcttgg aggacctaat gtgtgttggg      2760
     tgttgggcgg aacagtggac acagctgtgc tatggggttt ctttgcattg gatgtattga      2820
     gcatgcgatg ggctgtttaa ggtgtgaccc ctcactgtga tggatatgaa tttgttcatg      2880
     aatatttttt tctatagtgt gagacagctg ccttgtgtgg gactgagagg caagagttgt      2940
     tcctgccctt ccctttgtga cttgaagaac cctgactttg tttctgcaaa ggcacctgca      3000
     tgtgtctgtg ttcgtgtagg cataatgtga ggaggtgggg agaccacccc acccccatgt      3060
     ccaccatgac cctcttccca cgctgacctg tgct                                  3094
//