spacer

EBI Dbfetch

ID   AJ716156; SV 1; linear; genomic DNA; STD; HUM; 73 BP.
XX
AC   AJ716156;
XX
DT   24-MAY-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*4201variant,
DE   exon 1 and joined CDS
XX
KW   HLA-B gene; HLA-B*4202variant allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73
RA   Mrazek F.;
RT   ;
RL   Submitted (24-MAY-2004) to the INSDC.
RL   Mrazek F., Dept of Immunology, HLA laboratory, Palacky University Hospital,
RL   I.P.Pavlova str. 6, CZ-775 20, CZECH REPUBLIC.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2005.00376.x.
RX   PUBMED; 15730521.
RA   Mrazek F., Fae I., Ambruzova Z., Raida L., Indrak K., Petrek M.,
RA   Fischer G.F.;
RT   "A novel HLA-B*420502 allele identified by PCR-SSO/SSP routine typing and
RT   confirmed by Sequencing-based typing";
RL   Tissue Antigens 65(3):275-277(2005).
XX
DR   MD5; 55495506f7907614ac9c2278247a39fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,AJ716157.1:1..270,AJ716158.1:1..>276)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201variant"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q6KBS5"
FT                   /db_xref="IMGT/HLA:B*42:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KBS5"
FT                   /protein_id="CAG29814.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDKLERA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201variant"
FT                   /number=1
XX
SQ   Sequence 73 BP; 7 A; 30 C; 23 G; 13 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccg                                                           73
//


spacer
spacer