Dbfetch

ID   AJ715787; SV 1; linear; genomic DNA; STD; HUM; 352 BP.
XX
AC   AJ715787;
XX
DT   19-MAY-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-E gene for MHC class I antigen, HLA-E*0101 allele,
DE   exons 1-2
XX
KW   HLA-E gene; HLA-E*0101 allele; human leucocyte antigen E;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-352
RA   Weiss E.;
RT   ;
RL   Submitted (18-MAY-2004) to the INSDC.
RL   Weiss E., Anthropologie und Humangenetik, Department Biologie II, LMU,
RL   Luisenstr 37/EG, Munich, D-80333, GERMANY.
XX
RN   [2]
RA   Weiss E.;
RT   "unpublished HLA-E sequence";
RL   Unpublished.
XX
DR   MD5; 15855973fc6cf5cec0bc4b8e221ece11.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..352
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="JT, JOE"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..51,182..>352)
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0101"
FT   CDS             join(<1..51,182..>352)
FT                   /codon_start=3
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0101"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:E*01:01:01:01"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6KBZ5"
FT                   /protein_id="CAG29392.1"
FT                   /translation="LLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVD
FT                   DTQFVRFDNDAASPRMVPRAPWMEQEGS"
FT   exon            <1..51
FT                   /gene="HLA-E"
FT                   /allele="E*0101"
FT                   /number=1
FT   intron          52..181
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0101"
FT                   /number=1
FT   exon            182..>352
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0101"
FT                   /number=2
XX
SQ   Sequence 352 BP; 49 A; 118 C; 129 G; 56 T; 0 other;
     ccctcctttt actcctctcg gaggccctgg cccttaccca gacctgggcg ggtgagtgcg        60
     gggtcgggat ggaaacggcc tctaccggga gtagagaggg gccggcccgg cgggggcgaa       120
     ggactcgggg agccgcgccg ggaggagggt cgggccgatc tcagcccctc ctcgccccca       180
     ggctcccact ccttgaagta tttccacact tccgtgtccc ggcccggccg cggggagccc       240
     cgcttcatct ctgtgggcta cgtggacgac acccagttcg tgcgcttcga caacgacgcc       300
     gcgagtccga ggatggtgcc gcgggcgccg tggatggagc aggaggggtc ag               352
//