spacer

EBI Dbfetch

ID   AJ704546; SV 2; linear; genomic DNA; STD; HUM; 726 BP.
XX
AC   AJ704546;
XX
DT   06-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, exons 2-3,
DE   HLA-A*0235 allele
XX
KW   A*0235; HLA; HLA-A gene; human leukocyte antigen A;
KW   major histocompatability complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-726
RA   Binder T.M.C.;
RT   ;
RL   Submitted (06-MAY-2004) to the INSDC.
RL   Binder T.M.C., University Hospital Hamburg-Eppendorf, HLA Laboratory,
RL   Transfusion Medicine, Martinistrasse 52 (O49), D-20246 Hamburg, GERMANY.
XX
RN   [2]
RA   Binder T.M.C., Eiermann T.H., Machulla H.K.G.;
RT   "A new HLA-A*0235 variant, found in a German patient suffering from CLL";
RL   Unpublished.
XX
DR   MD5; 6dca4005673812573331de9e1393f34a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..726
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="peripheral blood"
FT                   /note="patient with chronic lymphocytic leukemia"
FT                   /db_xref="taxon:9606"
FT   intron          <1..20
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /number=1
FT   CDS             join(<21..290,431..>706)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5QRY8"
FT                   /db_xref="IMGT/HLA:A*02:35:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QRY8"
FT                   /protein_id="CAG28694.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAQSQTDRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            21..290
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /number=2
FT   intron          join(291..310,411..430)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /number=2
FT   gap             311..410
FT                   /estimated_length=unknown
FT   exon            431..706
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /number=3
FT   intron          707..>726
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0235"
FT                   /number=3
XX
SQ   Sequence 726 BP; 121 A; 190 C; 229 G; 86 T; 100 other;
     cagccactcc tcgtccccag gctctcactc catgaggtat ttcttcacat ccgtgtcccg        60
     gcccggccgc ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt       120
     gcggttcgac agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca       180
     ggaggggccg gagtattggg acggggagac acggaaagtg aaggcccagt cacagactga       240
     ccgagtggac ctggggaccc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc       300
     ccggcccggg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gaccgcgggg       420
     tccgggccag gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg       480
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       540
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       600
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       660
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgggtac caggggccac       720
     ggggcg                                                                  726
//


spacer
spacer