spacer

EBI Dbfetch

ID   AJ698898; SV 1; linear; genomic DNA; STD; ROD; 1271 BP.
XX
AC   AJ698898;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Acomys cahirinus partial Irbp gene for interphotoreceptor retinoid binding
DE   protein, tissue library T-633
XX
KW   interphotoreceptor retinoid binding protein; Irbp gene.
XX
OS   Acomys cahirinus (Egyptian spiny mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Acomys.
XX
RN   [1]
RP   1-1271
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   MD5; 9e1f7a262fe0e0eec3ad35215c44680c.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1271
FT                   /organism="Acomys cahirinus"
FT                   /mol_type="genomic DNA"
FT                   /country="Saudi Arabia"
FT                   /tissue_lib="T-633"
FT                   /db_xref="taxon:10068"
FT   CDS             <1..>1271
FT                   /codon_start=2
FT                   /gene="Irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q5CCD7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCD7"
FT                   /protein_id="CAG27723.1"
FT                   /translation="PENLMGMQATIEQAMKSREILGISDPQTLAQVLTAGVQSSLNDPR
FT                   LLISYEPSTLEAXQQVPELTNLTREDLLARIQRNIHHEVLEGNVGYLRVDDLPGQEVLS
FT                   ELGEFLVTHVWRQLMSTSSLVLDLRHCAGGHVSGIPYVVSYLHPGNTVMHVDTIYDRPS
FT                   NTTTEIWTLPRVLGERYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGA
FT                   LDLQKLRIGKSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTL
FT                   RRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSE
FT                   DPRLLVRATGPRETSCRPETGSNEPPAAVSEVPEEEAARRSLVDSVFQVSVLPGNVGYL
FT                   RFDRFADAPVLRALGPYVLHQVWE"
XX
SQ   Sequence 1271 BP; 261 A; 363 C; 395 G; 251 T; 1 other;
     ccctgagaat ctgatgggaa tgcaagcaac cattgagcag gctatgaaga gtcgtgagat        60
     tctgggcatc tcagaccctc agacgctggc ccaggtgctg acagctggag tgcagagttc       120
     cttgaacgac ccacggctcc tcatctccta tgagcccagt accctggagg ctcyccagca       180
     agtaccagag ctcaccaacc tcacccgaga agacctgctg gcccggatac agagaaatat       240
     ccaccacgag gttctggagg gcaacgtggg ttacctacga gtggatgacc tcccaggcca       300
     agaggtgctg agtgagctgg gggagttctt ggtgacccac gtgtggaggc agctcatgag       360
     tacctcctcc ttggtgctag atctccggca ctgcgcaggt ggtcatgtct ctgggatccc       420
     ttatgtcgtc tcctacttgc accccgggaa cactgtcatg cacgtagata ctatctacga       480
     tcgcccctcc aataccacca cagagatctg gaccttgccc agggtcctgg gggagagata       540
     cagtgctgac aaggatgtgg tagtcctcac cagtggacgt actgggggag tggctgagga       600
     tatcgcctac atcctcaagc agatgcgcag ggccatcgtg gtgggcgaga ggacagaggg       660
     cggtgccctg gacctccaga agctgagaat aggcaagtct aacttcttcc tcacagtgcc       720
     cgtgtccagg tccctgggac ccctgggtgg aggtggccag acatgggaag gcagtggagt       780
     gctgccctgc gtggggacac ctgcagagca ggccctggaa aaggccctgg ccatcctcac       840
     cctgcgccgt gccctgccgg gggttgtcct caggctgcag gaagccctgc aggactatta       900
     cacactggtg gaccgagtgc caggcctact acaccacctg gctagcatgg actactcagc       960
     tgtggtctct gaagaggacc tagtgacaaa gcttaacgct ggcttgcagg ctgtgtcgga      1020
     ggaccccagg ctcctggtaa gagccactgg acccagagaa acttcctgta ggcctgagac      1080
     tgggtctaat gagcctccag cagccgtgtc tgaggtgccc gaggaggaag ctgcccggag      1140
     gtccctggtg gactctgtgt ttcaggtgtc cgtactgcca ggcaacgtgg gctacctgcg      1200
     ctttgacaga tttgcagacg cccctgtgct gagggcgctg ggcccttacg tgttgcacca      1260
     ggtgtgggag c                                                           1271
//


spacer
spacer