spacer

EBI Dbfetch

ID   AJ698897; SV 1; linear; genomic DNA; STD; ROD; 1276 BP.
XX
AC   AJ698897;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Leopoldamys edwarsi partial Irbp gene for interphotoreceptor retinoid
DE   binding protein, tissue library T-864
XX
KW   interphotoreceptor retinoid binding protein; Irbp gene.
XX
OS   Leopoldamys edwardsi (Edwards's long-tailed giant rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Leopoldamys.
XX
RN   [1]
RP   1-1276
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   MD5; 9fd870f0ccea1fae2e749825953f2800.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1276
FT                   /organism="Leopoldamys edwardsi"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam"
FT                   /tissue_lib="T-864"
FT                   /db_xref="taxon:83756"
FT   CDS             <1..>1276
FT                   /codon_start=2
FT                   /gene="Irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q5CCD8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCD8"
FT                   /protein_id="CAG27722.1"
FT                   /translation="PENLMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPR
FT                   LFISYEPSTLEAPQQAPALTNLTREELLAQIQRNIRHEVLEGNVGYLRVDDLPGQEVLS
FT                   ELGEFLVSHVWKQLMDTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPS
FT                   NTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGA
FT                   LDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTL
FT                   RRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSE
FT                   DPRLLVRATGPRETPSRPETGPNDPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYL
FT                   RFDRFADASVLRTLGPYVLQQVWEPL"
XX
SQ   Sequence 1276 BP; 264 A; 370 C; 387 G; 254 T; 1 other;
     ccccgagaac ctgatgggga tgcaagcggc cattgagcag gctatgaaga gtcatgagat        60
     tctgggcatc tcagaccctc agacgctggc ccacgtgctg acagctggag tccagagctc       120
     tttgaatgac ccacgtctct tcatctccta tgaacccagt accctcgagg ctccccagca       180
     agcaccagca ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat       240
     ccgccatgag gttcttgagg gtaacgtggg ctacctacga gtggatgatc tccctggcca       300
     ggaggtactg agtgagctgg gggagttcct ggtgagccat gtgtggaagc agctcatgga       360
     cacctcttcc ttggtgctag atctccggca ctgtgctggt ggccatgtct ctgggatccc       420
     ttatgtcatc tcctacttgc accctgggaa cacagtcttg cacgtggata ccatctatga       480
     ccggccctcc aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata       540
     cagtgctgac aaggatgtgg tggtcctcac cagcggacac accgggggag tagctgagga       600
     tatcgcctac attctcaagc agatgcgaag ggccattgtg gtgggtgagc ggacggaggg       660
     tggcgccctg gacctccaga agctgagaat aggccagtcc aacttcttcc tcacagtgcc       720
     tgtgtccagg tccctggggc ccctgggtgg aggtggccag acatgggaag gcagtggagt       780
     gctgccctgt gtggggatac ctgcggagca agccctagaa aaggccctgg ccatccttac       840
     cctgcgccgt gccctgccag gggttgtcct ccgacttcag gaagccctac aggactatta       900
     cacattagtg gacagagtgc cgggcctgct gcaccacctg gccagcatgg attactcggc       960
     cgtggtgtcc gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcgga      1020
     ggaccccagg ctcctggtga gagccactgg acccagagaa accccctcaa gacctgagac      1080
     tggacctaat gaccctccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag      1140
     ggccctagtg gactctgtgt ttcaggtgtc cgtgctgcca ggcaacgtgg gctacctgcg      1200
     ctttgacaga tttgcagacg cctctgtgct gaggacgctg ggcccttayg tgctgcagca      1260
     ggtgtgggag cccctg                                                      1276
//


spacer
spacer