spacer

EBI Dbfetch

ID   AJ698895; SV 1; linear; genomic DNA; STD; ROD; 1276 BP.
XX
AC   AJ698895;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus platythrix partial Irbp gene for interphotoreceptor retinoid binding
DE   protein, strain PTX
XX
KW   interphotoreceptor retinoid binding protein; Irbp gene.
XX
OS   Mus platythrix (flat-haired mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Pyromys.
XX
RN   [1]
RP   1-1276
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   MD5; 5771938728ff00ec6d0e0bd3495e2a43.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC4280006; 25496476.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1276
FT                   /organism="Mus platythrix"
FT                   /strain="PTX"
FT                   /mol_type="genomic DNA"
FT                   /country="Thailand"
FT                   /tissue_lib="T-406"
FT                   /db_xref="taxon:10101"
FT   CDS             <1..>1276
FT                   /codon_start=2
FT                   /gene="Irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q5CCE0"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCE0"
FT                   /protein_id="CAG27720.1"
FT                   /translation="PENLMGMQAAIEQAMKSHEILGISDPQMLAQVLTAGVQSSLSDPR
FT                   LFISYEPSTLEAPQQAPAITNLTREELLAQIQRNIRHEVLEGNVGYLRVDDLPGQEVLS
FT                   ELGEFLVSHVWRQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTVYDRPS
FT                   NTTTEIWTLPEVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGA
FT                   LDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTL
FT                   RRALPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSE
FT                   DPRLLVRATGPRDSSSRPETGPNEPPADTPEVPKEEDARRALVDSVFQVSVLPGNVGYL
FT                   RFDRFADASVLETLGPYVLQRVWEPL"
XX
SQ   Sequence 1276 BP; 259 A; 373 C; 391 G; 253 T; 0 other;
     ccctgagaac ctgatgggaa tgcaagcagc cattgagcag gcgatgaaga gtcacgagat        60
     tctgggcatc tcagatcctc agatgctggc ccaagtgctg acagctggag tccagagttc       120
     cttgagtgac ccacgtctct tcatctctta cgagcccagt accctcgagg ctccccagca       180
     agcaccagca atcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat       240
     ccgccatgag gttcttgagg gcaacgtggg ctacctacgg gtggacgacc tccctggcca       300
     ggaggtactg agcgagctgg gggagttctt agtgagccac gtgtggaggc agctcatggg       360
     tacctcctcc ttggtgctag atctccggca ctgcgctggc ggccatgtct ctggaatccc       420
     ttatgtcatc tcttacttgc accctgggaa cacggtcatg cacgtggata ctgtctacga       480
     tcggccctcc aacaccacca cagagatatg gaccttgcct gaggtcctgg gggagagata       540
     cagtgctgac aaggatgttg tggtcctcac cagcggacac actgggggag tcgcggagga       600
     cattgcttac atcctgaagc agatgcgccg cgccatcgtg gtgggcgagc ggacggaggg       660
     tggggccctg gacctccaga agctgagaat aggccagtcc aacttcttcc tcacagtgcc       720
     tgtgtccagg tccctgggac ctctaggtgg aggtggccag acatgggaag gcagtggcgt       780
     actgccctgt gtggggaccc ctgcagagca agccctagaa aaggccctgg ccatcctcac       840
     cctgcgtcgt gccctgccag gggttgtcct ccgacttcag gaagccctcc aggactatta       900
     cacattagtg gaccgagtgc cgggcctgct gcaccacctg gccagcatgg actactcagc       960
     cgtggtctct gaagaggacc tggtgacaaa gctcaatgct ggcttacagg ctgtgtcgga      1020
     ggatcccagg ctcctggtga gagccaccgg acccagagac tcctcctcaa gacctgagac      1080
     tgggcctaat gagcccccag cagacacccc tgaggtgccc aaggaagaag atgcccggag      1140
     ggccctggtg gactctgtgt ttcaggtgtc tgtgctgccg ggcaatgtgg gctacctgcg      1200
     ctttgacaga tttgcagatg cctctgtgct ggagacgctg ggcccttacg tgctgcagcg      1260
     ggtgtgggag cctttg                                                      1276
//


spacer
spacer