spacer

EBI Dbfetch

ID   AJ698894; SV 1; linear; genomic DNA; STD; ROD; 1269 BP.
XX
AC   AJ698894;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus crociduroides partial Irbp gene for interphotoreceptor retinoid binding
DE   protein, tissue library T-1194
XX
KW   interphotoreceptor retinoid binding protein; Irbp gene.
XX
OS   Mus crociduroides (Sumatran shrewlike mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Coelomys.
XX
RN   [1]
RP   1-1269
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1269
FT                   /organism="Mus crociduroides"
FT                   /mol_type="genomic DNA"
FT                   /country="Indonesia:Sumatra"
FT                   /tissue_lib="T-1194"
FT                   /db_xref="taxon:41269"
FT   CDS             <1..>1269
FT                   /codon_start=2
FT                   /gene="Irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q5CCE1"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR024591"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCE1"
FT                   /protein_id="CAG27719.1"
FT                   /translation="PENLMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLSDPR
FT                   LFISYEPSIPEAPQQAPALTNLTREELLAQIQRNIRHEVLEGNVGYLRVDDLPGQEVLS
FT                   ELGEFLVSHVWRQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTVYDRPS
FT                   NTTTEIWTLPEVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGEXTEGGA
FT                   LDLQKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTL
FT                   RRALPGIVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSE
FT                   DPRLLVRATGPRDSSSRPESGPNEPPAVTPEVPEEEAARRALVDSVFQVSVLPGNVGYL
FT                   RFDRFADASVLGTLGPYVLQQVW"
XX
SQ   Sequence 1269 BP; 253 A; 378 C; 386 G; 251 T; 1 other;
     ccctgagaac cttatgggaa tgcaagcagc cattgagcag gcgatgaaga gtcacgagat        60
     tctgggcatc tcagaccctc agacgctggc ccatgtgctg acagccggag tccagagttc       120
     cttgagtgac ccacgtctct tcatctctta cgagcccagt atccctgagg ctccccaaca       180
     agcgccagcg ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat       240
     ccgccatgag gttcttgagg gcaacgtggg ctacctacgc gtggacgacc tccctggcca       300
     ggaggtactg agcgagctgg gggagttctt ggtgagccac gtgtggaggc agctcatggg       360
     cacctcctcc ttggtgctag atctccggca ctgcgctggc ggccatgttt ctgggatccc       420
     ttatgtcatc tcttacttgc accctgggaa cacggtcatg cacgtggata ccgtctacga       480
     ccggccctcc aacaccacca cagagatctg gaccttgccc gaggtcctcg gggagagata       540
     cagtgctgac aaggatgtgg tggtcctcac cagcggacac actgggggag tcgcagagga       600
     cattgcctac atcctgaagc agatgcgccg tgccatcgtg gtgggcgagc rgacggaggg       660
     tggggccttg gacctccaga agctgagaat aggccagtcc aacttcttcc tcacagtgcc       720
     tgtatccagg tccctgggac ctctaggtgg aggtggccag acatgggaag gcagtggtgt       780
     gctgccctgt gtggggaccc ctgcagagca agccctagaa aaggccctgg ccatcctcac       840
     cctgcgtcgt gccctgccag ggattgtcct ccgacttcag gaagccctcc aggactatta       900
     cacattagtg gaccgagtgc cgggcctgct gcaccacctg gccagcatgg actactcagc       960
     cgtggtctct gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcaga      1020
     ggatcccagg ctcctggtga gagccactgg acccagagac tcctcctcaa gacctgagtc      1080
     tgggcctaat gagcctccag cagtcacccc tgaggtgccc gaggaagaag ctgcccgaag      1140
     ggccctggtg gactctgtgt ttcaggtgtc cgtgctgcca ggcaatgtgg gctacctgcg      1200
     ctttgacaga tttgcagacg cctctgtgct ggggacgctg ggcccttatg tgctgcagca      1260
     ggtgtggga                                                              1269
//


spacer
spacer