spacer

EBI Dbfetch

ID   AJ698881; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AJ698881;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Leopoldamys edwarsi mitochondrial partial Cytb gene for cytochrome b,
DE   tissue library T-1409
XX
KW   Cytb gene; cytochrome b.
XX
OS   Leopoldamys edwardsi (Edwards's long-tailed giant rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Leopoldamys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   MD5; b4d8c8360ad6a621b20c850ba4f33e25.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Leopoldamys edwardsi"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam"
FT                   /tissue_lib="T-1409"
FT                   /db_xref="taxon:83756"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="Cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q5CCF4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCF4"
FT                   /protein_id="CAG27706.1"
FT                   /translation="MTNIRKTHPLFKIINDSFIDLPTPSNISSWWNFGSLLGVCLVVQI
FT                   ITGLFLAMHYTPDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFFCLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLDSNADKIPFHP
FT                   YYTIKDLLGVLMLFLFLMTMVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFVYAIL
FT                   RSIPNKLGGVVALVLSILVLAFLPFLHTSKQRTLIFRPITQALYWILVANLFILTWIGS
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 336 A; 339 C; 145 G; 320 T; 0 other;
     atgacaaaca tccgaaaaac tcaccctcta tttaaaatca tcaatgactc cttcattgac        60
     ctcccaaccc catcaaatat ctcatcatga tgaaactttg gctctcttct aggcgtctgt       120
     cttgtagtac aaatcattac aggtctattc ctagcaatac attacacacc agatacaata       180
     acagcatttt catcagtcac ccatatctgc cgagatgtaa actatggctg actaatccga       240
     tacttgcatg caaacggagc ctccatattc ttcttctgcc tgttccttca cgtaggacga       300
     ggcatgtact atggatccta tacttttata gaaacctgaa acatcggagt aatcctgcta       360
     ttcaccgtaa tagctactgc atttataggc tacgtcctcc catgaggaca aatatccttc       420
     tgaggagcaa cagtaattac aaacctactg tcagctatcc cgtacatcgg aaccaccctg       480
     gtagaatgaa tttgaggtgg tttctcagta gacaaagcaa ccctaacacg cttcttcgca       540
     tttcacttta tcctcccctt catcatcgca gcccttgtaa ttgtccacct tctattcctt       600
     cacgaaacag gatcaaacaa ccctactgga ctggattcca acgcagacaa aatcccattc       660
     cacccatact atacaattaa agaccttcta ggagtcctca tactcttcct attcctcata       720
     actatagttt tattcttccc agacctccta ggagacccag acaattatac acctgctaac       780
     cccctaaaca ccccgcccca tattaaacca gaatgatact tcctcttcgt ttacgccatc       840
     ctacgctcta tccctaacaa attaggagga gttgtagccc tagtcctatc aattctagtc       900
     ctagccttcc taccattcct acatacctca aaacaacgca cccttatctt ccgtccaatc       960
     acccaagctc tttactgaat cctagtagcc aaccttttca tcttaacatg aattggcagc      1020
     caaccagtcg aacacccatt tattatcatc ggccagttag cctccatcag ctacttctca      1080
     atcatcctca tccttatacc aatctccgga atcattgaag ataaaatact aaaatgaaac      1140
//


spacer
spacer