spacer

EBI Dbfetch

ID   AJ698880; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AJ698880;
XX
DT   19-MAR-2005 (Rel. 83, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus platythrix mitochondrial partial Cytb gene for cytochrome b, strain PTX
XX
KW   Cytb gene; cytochrome b.
XX
OS   Mus platythrix (flat-haired mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Pyromys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.D.;
RT   ;
RL   Submitted (29-APR-2004) to the INSDC.
RL   Chevret P.D., Laboratoire de Paleontologie, cc 064, ISEM (UMR5554),
RL   Universite Montpellier 2, Place E. Bataillon, 34095 Montpellier cedex 5,
RL   FRANCE.
XX
RN   [3]
RA   Chevret P.D., Veyrunes F., Britton-Davidian J.;
RT   "Molecular phylogeny of the genus Mus (Rodentia: Murinae) based
RT   onmitochondrial and nuclear data";
RL   Biol. J. Linn. Soc. Lond. 84(3):417-427(2005).
XX
DR   MD5; 9040923908e4c02fea1544f1e7c8a794.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mus platythrix"
FT                   /organelle="mitochondrion"
FT                   /strain="PTX"
FT                   /mol_type="genomic DNA"
FT                   /country="Thailand"
FT                   /tissue_lib="T-406"
FT                   /db_xref="taxon:10101"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="Cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q5CCF5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CCF5"
FT                   /protein_id="CAG27705.1"
FT                   /translation="MTNMRKAHPLFKIINHSFIDLPAPSNISSWWNFGSLLGICLLVQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLIMLLTLMTLVLFFPDMLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPLLHTSKQRSLTFRPITQILYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFTIILVLMPISGIIEDKMLKLY"
XX
SQ   Sequence 1140 BP; 360 A; 296 C; 143 G; 341 T; 0 other;
     atgacaaaca tacgaaaggc acatccatta tttaaaatta ttaatcactc cttcatcgac        60
     ctacctgccc catccaatat ctcatcatga tggaactttg gctccctcct aggcatttgc       120
     ctactagttc aaatcattac aggcctattc ctagcaatac attacacatc agacacaata       180
     acagctttct catcagtaac tcacatttgt cgagacgtaa attacggctg actgattcga       240
     tatatacatg caaacggagc ctccatattc tttatttgct tatttcttca cgtcggacga       300
     ggaatatact acggatctta tacattcata gaaacctgaa acatcggagt catcctatta       360
     tttgcagtaa tagctactgc attcataggc tacgtacttc catgaggaca gatatcattt       420
     tgaggggcaa cagtaattac aaatctttta tcagctattc catacatcgg aacaacacta       480
     gttgaatgaa tttgaggagg attctcggta gacaaagcca ctctgactcg attcttcgcc       540
     ttccacttca tcctaccatt catcattaca gccctagtaa ttgtccatct acttttcctc       600
     catgaaacag gatcaaacaa ccctacaggc ctaaactcag acgcagacaa aatcccattt       660
     catccatact atacaattaa agatatctta ggagtactaa ttatattact aacacttata       720
     actctagtac tattcttccc agacatacta ggagaccccg ataactatac accagccaat       780
     ccactcaata ccccacccca cattaaaccc gagtgatatt tcctatttgc atatgccatt       840
     ttacgttcta ttcctaacaa actaggaggc gttctggccc taattttatc aattctaatc       900
     ttagccctac taccactact tcacacttct aaacaacgaa gcctaacctt tcggccaatc       960
     acccaaattc tttactgaat ccttgtagct aacctattag ttctaacctg aattgggggt      1020
     caaccagtcg aacacccatt cattattatc ggtcaattag cttcaatttc ctacttcacc      1080
     attatcttag tcctaatacc aatctcagga attattgaag acaaaatatt aaaactatac      1140
//


spacer
spacer