Dbfetch

ID   AJ697951; SV 1; linear; genomic DNA; STD; HUM; 73 BP.
XX
AC   AJ697951;
XX
DT   22-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, isolate 27720,
DE   HLA-A*new allele, exon 1 and joined CDS
XX
KW   HLA-A gene; HLA-A*new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (22-APR-2004) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RA   Voorter C.E., van den Berg-Loonen E.M.;
RT   "New HLA-A allele detected by SBT";
RL   Unpublished.
XX
DR   MD5; 1cdf1f1f03a6ae53bca5b6338d4d4de2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..73
FT                   /organism="Homo sapiens"
FT                   /isolate="27720"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,AJ697952.1:1..270,AJ697953.1:1..276,
FT                   AJ697954.1:1..>276)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*01:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0E7X3"
FT                   /protein_id="CAG27091.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=1
XX
SQ   Sequence 73 BP; 8 A; 31 C; 22 G; 12 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgg                                                           73
//