Dbfetch

ID   AJ697942; SV 2; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AJ697942; AJ697943;
XX
DT   22-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*1118 allele,
DE   exons 1-4, isolate 28003
XX
KW   HLA-A gene; HLA-A*1118 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [05-MAY-2006]
RP   1-1195
RA   van den Berg-Loonen E.M.;
RT   ;
RL   Submitted (22-APR-2004) to the INSDC.
RL   van den Berg-Loonen E.M., Tissue Typing Laboratory, University Hospital
RL   Maastricht, P.O. Box 5800, 6202 AZ Maastricht, NETHERLANDS.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2006.00702.x.
RX   PUBMED; 17176445.
RA   Voorter C.E.M., Gervais T., Palusci F., Latinne D.,
RA   van den Berg-Loonen E.M.;
RT   "A novel HLA-A*11 allele, A*1118, identified by sequence-based typing";
RL   Tissue Antigens 68(6):524-526(2006).
XX
DR   MD5; affd13d0e5bc2a7feef795d33149a065.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /isolate="28003"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1118"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0E7X7"
FT                   /db_xref="IMGT/HLA:A*11:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0E7X7"
FT                   /protein_id="CAG27087.2"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1118"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1118"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1118"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..>1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1118"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 176 A; 285 C; 306 G; 128 T; 300 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccagga       360
     gacacggaat gtgaaggccc actcacagac tcaccgagtg gacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag ataatgtatg gctgcgacgt ggggccggac gggcgcttcc       600
     tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcag ctcagatcac caagcgcaag tgggaggcgg       720
     cccatgcggc ggagcagcag agagcctacc tggagggccg gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cccccccaag acacatatga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggg           1195
//