spacer

EBI Dbfetch

ID   AJ697892; SV 1; linear; mRNA; STD; HUM; 818 BP.
XX
AC   AJ697892;
XX
DT   07-JAN-2005 (Rel. 82, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial mRNA for MHC class II antigen (HLA-D gene),
DE   HLA-DRB1*1115-H282 allele
XX
KW   HLA-D gene; HLA-DRB1*1115-H282 allele; human leucocyte antigene D;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-818
RA   Vilches C.;
RT   ;
RL   Submitted (20-APR-2004) to the INSDC.
RL   Vilches C., Inmunologia, H.U. Puerta de Hierro, 4 San Martin de Porres,
RL   28035, SPAIN.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2005.00407.x.
RX   PUBMED; 15896200.
RA   Vilches C., Sepulveda S., Balas A., Solis R., Aviles M.J., Estefania E.,
RA   Gomez-Lozano N., Vicario J.L., DePablo R.;
RT   "Complete coding sequences and haplotypic associations of HLA-B*0707,
RT   -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305,
RT   and the novel allele -DRB1*0709. Group-specific amplification of cDNA from
RT   DRB1 alleles associated to DRB3 and DRB4";
RL   Tissue Antigens 65(6):529-538(2005).
XX
DR   MD5; 0e18f00b58c0506a76b94d839c08a6f4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..818
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..9
FT   CDS             10..810
FT                   /gene="HLA-D"
FT                   /allele="HLA-DRB1*1115-H282"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5K3W3"
FT                   /db_xref="IMGT/HLA:DRB1*11:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K3W3"
FT                   /protein_id="CAG27025.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFYNQEEDLRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEDRRAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
FT   3'UTR           811..>818
XX
SQ   Sequence 818 BP; 176 A; 204 C; 262 G; 176 T; 0 other;
     ttctccagca tggtgtgtct gaggctccct ggaggctcct gcatggcagt tctgacagtg        60
     acactgatgg tgctgagctc cccactggct ttggctgggg acaccagacc acgtttcttg       120
     gagtactcta cgtctgagtg tcatttcttc aatgggacgg agcgggtgcg gttcctggac       180
     agatacttct ataaccaaga ggaggacttg cgcttcgaca gcgacgtggg ggagttccgg       240
     gcggtgacgg agctggggcg gcctgatgag gagtactgga acagccagaa ggacttcctg       300
     gaagacaggc gggccgcggt ggacacctac tgcagacaca actacggggt tggtgagagc       360
     ttcacagtgc agcggcgagt ccatcctaag gtgactgtgt atccttcaaa gacccagccc       420
     ctgcagcacc acaacctcct ggtctgttct gtgagtggtt tctatccagg cagcattgaa       480
     gtcaggtggt tccggaatgg ccaggaagag aagactgggg tggtgtccac aggcctgatc       540
     cacaatggag actggacctt ccagaccctg gtgatgctgg aaacagttcc tcggagtgga       600
     gaggtttaca cctgccaagt ggagcaccca agcgtgacaa gccctctcac agtggaatgg       660
     agagcacggt ctgaatctgc acagagcaag atgctgagtg gagtcggggg ctttgtgctg       720
     ggcctgctct tccttggggc cgggctgttc atctacttca ggaatcagaa aggacactct       780
     ggacttcagc caagaggatt cctgagctga agtgcaga                               818
//


spacer
spacer